KEGG   Loxodonta africana (African savanna elephant): 100675268
Entry
100675268         CDS       T04351                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04071  Sphingolipid signaling pathway
lav04115  p53 signaling pathway
lav04140  Autophagy - animal
lav04141  Protein processing in endoplasmic reticulum
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04261  Adrenergic signaling in cardiomyocytes
lav04340  Hedgehog signaling pathway
lav04510  Focal adhesion
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04915  Estrogen signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05215  Prostate cancer
lav05222  Small cell lung cancer
lav05226  Gastric cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100675268 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100675268 (BCL2)
   04630 JAK-STAT signaling pathway
    100675268 (BCL2)
   04064 NF-kappa B signaling pathway
    100675268 (BCL2)
   04066 HIF-1 signaling pathway
    100675268 (BCL2)
   04071 Sphingolipid signaling pathway
    100675268 (BCL2)
   04151 PI3K-Akt signaling pathway
    100675268 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100675268 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100675268 (BCL2)
   04215 Apoptosis - multiple species
    100675268 (BCL2)
   04217 Necroptosis
    100675268 (BCL2)
   04115 p53 signaling pathway
    100675268 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675268 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100675268 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100675268 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100675268 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100675268 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100675268 (BCL2)
   04722 Neurotrophin signaling pathway
    100675268 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675268 (BCL2)
   05206 MicroRNAs in cancer
    100675268 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100675268 (BCL2)
   05226 Gastric cancer
    100675268 (BCL2)
   05215 Prostate cancer
    100675268 (BCL2)
   05222 Small cell lung cancer
    100675268 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100675268 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100675268 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100675268 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100675268 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100675268 (BCL2)
   05152 Tuberculosis
    100675268 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100675268 (BCL2)
   05161 Hepatitis B
    100675268 (BCL2)
   05162 Measles
    100675268 (BCL2)
   05168 Herpes simplex virus 1 infection
    100675268 (BCL2)
   05169 Epstein-Barr virus infection
    100675268 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100675268 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100675268 (BCL2)
   01524 Platinum drug resistance
    100675268 (BCL2)
   01522 Endocrine resistance
    100675268 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100675268 (BCL2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100675268 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100675268
NCBI-ProteinID: XP_003406316
UniProt: G3SLZ1
LinkDB
Position
Unknown
AA seq 229 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGEASAAPPGAAPAPGVLSSPPAAPRGPD
TRTSPLQADPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQ
DNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgcacgcagggagaacaggttatgacaaccgggagatagtgatgaagtatatccac
tataagctgtcgcagcggggctacgaatgggaggctggcgaagctagcgccgcgcccccc
ggggccgctcccgcgccgggcgtcctctcttctccgcccgcggcgccccggggcccggac
accaggacctcgccgctccaggctgacccggccgcgcagccggcgctcagcccggtgcca
cctgtagttcacctgaccttgcgccaggccggcgacgacttctccaggcgctaccgccgc
gacttcgccgagatgtcgagccagctgcacctgactcccttcaccgcgaggggacgcttt
gccacggtggtggaggagctcttcagggacggggtgaactgggggcggattgtggccttc
tttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg
gacaacatcgccctctggatgactgagtacctgaaccggcacctgcacacctggatccag
gataacggaggatgggatgcctttgtggaactgtatggccccaacatgcgacctctgttt
gatttctcctggctgtctctgaagacactgctcagtctggccctggtgggagcttgcatc
accctgggtgcttacctggggcacaagtga

DBGET integrated database retrieval system