KEGG   Loxodonta africana (African savanna elephant): 100675292
Entry
100675292         CDS       T04351                                 

Gene name
PTGER3
Definition
(RefSeq) prostaglandin E2 receptor EP3 subtype
  KO
K04260  prostaglandin E receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04923  Regulation of lipolysis in adipocytes
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100675292 (PTGER3)
   04024 cAMP signaling pathway
    100675292 (PTGER3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100675292 (PTGER3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100675292 (PTGER3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675292 (PTGER3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100675292 (PTGER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100675292 (PTGER3)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100675292 (PTGER3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 100675292
NCBI-ProteinID: XP_010589495
LinkDB
Position
Unknown
AA seq 376 aa
MKETRVCTGLNPSYPSMWAPGNLTSSTELREGCGSVSVAFPITMLITGFVGNALAMLLVS
RSYPRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEQLDPSGRLCTFFG
LTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLTFALLPVL
GVGQYTVQWPGTWCFISTGGGGNGTSSRDNWGNLFFASTFAFLGLAALAITFACNLATIK
ALVSRCRAKAMASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEH
CKSQMEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRYHTNNYVSSSTSL
PHQCSSTLMCSDHLER
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaggagacaagggtctgcaccggtctcaatccttcctatcccagcatgtgggcgccg
ggcaacctcacgagttccacggagctccgagaagggtgcggctccgtgtcggtggccttc
ccgatcaccatgttgatcactggcttcgtgggcaacgcactggccatgctgctcgtgtct
cggagctacccgcgccgcgagagcaagcgcaaaaagtccttcctgctgtgcatcggctgg
ttggcgctcaccgacctggtcggacagctgctcaccaccccagtggtgatcgtcgtgtac
ctgtccaagcagcgctgggagcagctcgacccgtcggggcggctgtgcactttcttcggt
ctgaccatgactgtcttcgggctctcttcgcttttcatcgccagcgccatggccgtcgaa
agggcgctggccatccgggcgccgcactggtacgcgagccacatgaagacgcgcgccacc
cgcgcggtgctgctcggtgtgtggctggcggtgctcaccttcgccctgctgcctgtgctg
ggcgtgggccagtacaccgtccagtggcccgggacgtggtgcttcatcagcaccggggga
gggggcaacgggactagctcccgggacaactggggcaaccttttctttgcctctaccttt
gccttcctggggctcgcagcgctggccatcaccttcgcctgcaacctggccactattaag
gccctggtgtctcgctgccgcgccaaggccatggcgtcgcaatccagcgcccagtggggc
cggatcacgaccgaaacggccatccagctcatggggatcatgtgcgtgttgtcagtctgc
tggtcaccgctgctgataatgatgttgaaaatgatcttcaatcagacgtcagttgagcac
tgcaagagtcagatggaaaagcagaaagaatgcaacttcttcttaatagctgttcgcctg
gcttcgttgaaccagatcttggacccctgggtttatctgctgctaagaaagatcctcctt
cgaaagttttgccagatcaggtaccacacaaacaactatgtatccagctccacctccttg
ccccaccagtgttcctcaactttgatgtgcagtgatcatttggaaaggtga

DBGET integrated database retrieval system