KEGG   Loxodonta africana (African savanna elephant): 100675411
Entry
100675411         CDS       T04351                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100675411 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100675411 (PLK1)
   04114 Oocyte meiosis
    100675411 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100675411 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100675411 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100675411 (PLK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100675411 (PLK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100675411 (PLK1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100675411 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100675411 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    100675411 (PLK1)
SSDB
Motif
Pfam: Pkinase POLO_box PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100675411
NCBI-ProteinID: XP_003418952
LinkDB
Position
Unknown
AA seq 604 aa
MSAVVTAGKLARAPAETGKTGAPGIAVPGATASAPPAKEIPEVLVDPRSRRRYLRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINHLAASLIQKMLQTDPTARPTISELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGVENPVPERPREKEE
PVVQETGEAVDCHLGDMLQQLHSVNAAKPSERGLVRQEEAEDPACIPIFWISKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGESLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGCVQINFFQDHTK
LILCPLMAAVTYINEKRDFRTYRLSLLEEHGCSKELASRLRYARTMVDKLLSSRSASNRL
KASS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgagtgcggtggtgacggcagggaagctggcacgggcaccggcagagaccgggaagacc
ggggccccgggaattgcggttcccggggctacggcgtccgccccgccggcgaaagagatc
ccggaggtcctagtggatccgcgcagccggcggcgctatctgcgcggtcgcttcctgggc
aagggaggctttgccaagtgcttcgagatctcggacgcagacaccaaggaggtgttcgcc
ggcaagatcgtgcctaagtcgctgttgctcaagccgcaccagaaggagaagatgtccatg
gaaatatctattcaccgcagcctcgcccaccagcacgtcgtcggcttccacggctttttc
gaggacaacgactttgtgttcgtggtgctggagctctgccgccggaggtcccttctggag
ctgcacaaacggaggaaagcgctgacagagcctgaggcccgctactacctgcggcagata
gtccttggctgccagtacttgcaccgaaaccgtgtcattcaccgggacctcaagctgggc
aacctctttctgaatgaagacctggaggtgaaaataggggattttggactggccaccaaa
gttgagtatgacggggagcggaagaagaccctgtgtgggactcctaattacattgctcct
gaggtgctgagcaagaaagggcacagtttcgaggtggatgtgtggtctattgggtgcatc
atgtataccttattagtgggcaagccaccgtttgagacttcctgcctaaaagagacttac
ctccggatcaagaagaatgaatacagtatacccaagcacatcaaccacctggctgcctcc
ctcatccagaaaatgcttcagacggatcccactgcccgcccaaccattagcgagctgctc
aacgatgagttctttacttctggttacatccctgcccgtctccccatcacctgcctcacc
attccacctaggttttcaattgctcccagcagcctggaccccagcaaccggaagcctctc
acagtcctcaataaaggtgtggaaaaccccgtgcctgagcgtcctcgggaaaaagaggag
ccagtggttcaggagacaggtgaggcagtcgactgccaccttggtgacatgctgcagcag
ctacacagcgtcaatgctgcaaagccctcagagcgggggctggtgaggcaagaggaggct
gaggatcccgcctgcattcccatcttctggatcagcaaatgggtggactattcagacaag
tatggccttgggtatcagctgtgtgacaatagcgtgggggtgctcttcaatgactcaacc
cgccttatcctctacaatgacggtgagagcctgcagtacattgagcgcgacggcacagag
tcctacctcaccgtcagctcccatcccaactccttgatgaagaagatcacactcctgaag
tatttccgaaattacatgagtgaacacttgctgaaggctggtgccaatatcacaccacgg
gaaggtgatgagctagcccggctaccatacctgcgtacctggttccgcacccgtagcgcc
atcatcctacacctcagcaatggctgtgtgcagatcaacttcttccaggaccacaccaaa
ctcatcctgtgccccctaatggcggccgtgacctacatcaacgagaagcgggacttccgc
acataccgcctgagccttcttgaggagcatggctgctccaaggagctggccagccggctc
cgctatgcacgcaccatggtggacaagctgctgagctcacgctccgcctccaaccgcctc
aaggcctcctcatag

DBGET integrated database retrieval system