KEGG   Loxodonta africana (African savanna elephant): 100675475
Entry
100675475         CDS       T04351                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04137  Mitophagy - animal
lav04144  Endocytosis
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04540  Gap junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04625  C-type lectin receptor signaling pathway
lav04727  GABAergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05219  Bladder cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100675475 (SRC)
   04015 Rap1 signaling pathway
    100675475 (SRC)
   04370 VEGF signaling pathway
    100675475 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100675475 (SRC)
   04137 Mitophagy - animal
    100675475 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675475 (SRC)
   04520 Adherens junction
    100675475 (SRC)
   04530 Tight junction
    100675475 (SRC)
   04540 Gap junction
    100675475 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100675475 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675475 (SRC)
   04613 Neutrophil extracellular trap formation
    100675475 (SRC)
   04625 C-type lectin receptor signaling pathway
    100675475 (SRC)
   04062 Chemokine signaling pathway
    100675475 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675475 (SRC)
   04915 Estrogen signaling pathway
    100675475 (SRC)
   04917 Prolactin signaling pathway
    100675475 (SRC)
   04921 Oxytocin signaling pathway
    100675475 (SRC)
   04926 Relaxin signaling pathway
    100675475 (SRC)
   04919 Thyroid hormone signaling pathway
    100675475 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    100675475 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675475 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    100675475 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100675475 (SRC)
   05203 Viral carcinogenesis
    100675475 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    100675475 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100675475 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100675475 (SRC)
   05152 Tuberculosis
    100675475 (SRC)
   05100 Bacterial invasion of epithelial cells
    100675475 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100675475 (SRC)
   05168 Herpes simplex virus 1 infection
    100675475 (SRC)
   05163 Human cytomegalovirus infection
    100675475 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675475 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100675475 (SRC)
   01522 Endocrine resistance
    100675475 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100675475 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100675475 (SRC)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100675475 (SRC)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  SRC family
   100675475 (SRC)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100675475 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100675475 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100675475 (SRC)
  Macropinocytosis
   Kinases
    100675475 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 100675475
NCBI-ProteinID: XP_003411752
LinkDB
Position
Unknown
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPTENTHGGGGGAFPSSQTPSKPASADGHRGSNTAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNTENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaataagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
accgagaacacccatggtggcggtgggggagccttccccagctcacagacccccagcaag
ccagcctctgctgatggtcaccgcggctccaacacggcctttgccccagcagctgccgag
cccaagctctttggaggcttcaactcctcggacacagtcacctccccacagagggcaggg
ccactggctggtggagtgaccacctttgtggccctctacgactatgagtcgaggacagag
actgacttgtccttcaagaagggggagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcaccggacagacgggctacataccgagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtactttggcaagattaccagaagggag
tcagaaaggttgttgctcaatacggaaaaccctcgagggaccttcctagtgcgagaaagc
gagaccacgaaaggtgcctactgcctctccgtgtctgactttgacaatgccaagggcctc
aatgtgaagcactacaagatccgcaagctagacagcggcggcttctacattacctcccgc
acccagttcaacagcctgcagcagctcgtggcttactattccaaacacgccgatggcctc
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gacgcctgggagatcccccgggagtcgttgcggctggaggtcaagctgggccagggctgc
ttcggggaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagccgggcaccatgtcgccagaggcctttctgcaggaggcccaggtcatgaagaaactg
aggcatgagaagctggtgcagctgtatgccgtcgtgtccgaggagcccatctatatcgtc
actgagtacatgagcaaggggagtttgctggactttctcaagggggaaacgggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagattgcctcaggcatggcgtatgtg
gagaggatgaactacgtccaccgggacctccgtgctgccaacatcctggttggagagaac
ctggtatgcaaagtggctgacttcgggctggctcgactcatagaagacaacgagtacact
gcccggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctgtatggc
cgattcaccatcaagtcagacgtgtggtcctttgggatcctgctgacggagctcacaaca
aagggacgggtgccctaccctgggatggtgaaccgagaggttctggaccaggtggagcgg
ggctaccggatgccttgcccacctgagtgtcccgagtccctgcatgacctcatgtgccag
tgttggcggaaggagccagaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggcgagaacctatag

DBGET integrated database retrieval system