KEGG   Loxodonta africana (African savanna elephant): 100675535
Entry
100675535         CDS       T04351                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X2
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04360  Axon guidance
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04520  Adherens junction
lav04611  Platelet activation
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04725  Cholinergic synapse
lav05020  Prion disease
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100675535 (FYN)
   04071 Sphingolipid signaling pathway
    100675535 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675535 (FYN)
   04520 Adherens junction
    100675535 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675535 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    100675535 (FYN)
   04660 T cell receptor signaling pathway
    100675535 (FYN)
   04664 Fc epsilon RI signaling pathway
    100675535 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    100675535 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    100675535 (FYN)
   04380 Osteoclast differentiation
    100675535 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100675535 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100675535 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100675535 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100675535 (FYN)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100675535 (FYN)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  SRC family
   100675535 (FYN)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100675535 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    100675535 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 100675535
NCBI-ProteinID: XP_003404334
LinkDB
Position
Unknown
AA seq 534 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSEKDDGLCF
NLTVIAPSCTPQTSGLAKDAWEVARDSLFLEKKLGQGCFAEVWLGTWNGNTKVAIKTLKP
GTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALK
LPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGHGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGY
RMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggatggc
agcctgaaccagagctctgggtaccgatatggcacagaccccacccctcagcactacccc
agcttcggcgtgacctccatcccaaactacaacaacttccacgcagcagggggccaagga
ctcaccgtctttgggggtgtgaactcttcgtctcatactgggaccttgcgcacaagagga
ggaacaggagtgaccctgtttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagctcgctccctgacaactggagagacgggctacattcccagcaattatgtggctcca
gttgactccatccaagcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagcttttgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgactgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactatattactacccgggcccag
tttgaaacgcttcagcagcttgtacagcattactcagagaaagatgatggtttgtgtttt
aacttaactgtgattgcaccgagttgtaccccacaaacttctggattggctaaagatgct
tgggaagttgcacgtgattcgttgtttctggagaagaagctgggtcaggggtgtttcgct
gaagtgtggcttggtacctggaatggaaacacaaaagtagccataaagactcttaaacca
ggcacaatgtcccctgaatcattcctcgaggaagcgcagatcatgaagaagttgaaacat
gacaagttggtccagctgtacgcagtggtgtctgaggaacccatctacattgtcaccgag
tatatgaataaaggaagtttacttgatttcttaaaagatggagaaggaagagctctgaaa
ttaccaaatcttgtggacatggcagcacaggttgctgcgggaatggcttacatcgagcgc
atgaattatatacatagagacctacgatcggcaaacattctagtcgggcatggactaata
tgcaagatcgctgactttggattggcccggttgatcgaagacaatgaatacacagcaaga
caaggtgcaaaattccccattaagtggacagcccctgaagcagccctgtacgggaggttc
acaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtcaccaaagga
agagtgccgtacccaggcatgaacaaccgggaggtgctggagcaggtggagcgtggctac
aggatgccctgtccgcaggactgccccatctctctacatgagctcatgatccactgctgg
aaaaaggaccccgaagaacgccccacttttgagtacttgcagggcttcctggaagattac
tttaccgcaacagagccccagtaccaaccaggtgaaaacctgtag

DBGET integrated database retrieval system