KEGG   Loxodonta africana (African savanna elephant): 100675651
Entry
100675651         CDS       T04351                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04926  Relaxin signaling pathway
lav04931  Insulin resistance
lav05132  Salmonella infection
lav05134  Legionellosis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100675651 (NFKBIA)
   04668 TNF signaling pathway
    100675651 (NFKBIA)
   04024 cAMP signaling pathway
    100675651 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100675651 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100675651 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100675651 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100675651 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100675651 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100675651 (NFKBIA)
   04660 T cell receptor signaling pathway
    100675651 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100675651 (NFKBIA)
   04659 Th17 cell differentiation
    100675651 (NFKBIA)
   04657 IL-17 signaling pathway
    100675651 (NFKBIA)
   04662 B cell receptor signaling pathway
    100675651 (NFKBIA)
   04062 Chemokine signaling pathway
    100675651 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100675651 (NFKBIA)
   04926 Relaxin signaling pathway
    100675651 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100675651 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100675651 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675651 (NFKBIA)
   05203 Viral carcinogenesis
    100675651 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100675651 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100675651 (NFKBIA)
   05215 Prostate cancer
    100675651 (NFKBIA)
   05222 Small cell lung cancer
    100675651 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100675651 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100675651 (NFKBIA)
   05135 Yersinia infection
    100675651 (NFKBIA)
   05134 Legionellosis
    100675651 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100675651 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100675651 (NFKBIA)
   05161 Hepatitis B
    100675651 (NFKBIA)
   05160 Hepatitis C
    100675651 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    100675651 (NFKBIA)
   05164 Influenza A
    100675651 (NFKBIA)
   05162 Measles
    100675651 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100675651 (NFKBIA)
   05163 Human cytomegalovirus infection
    100675651 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675651 (NFKBIA)
   05169 Epstein-Barr virus infection
    100675651 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100675651 (NFKBIA)
   05140 Leishmaniasis
    100675651 (NFKBIA)
   05142 Chagas disease
    100675651 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100675651 (NFKBIA)
   04131 Membrane trafficking [BR:lav04131]
    100675651 (NFKBIA)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100675651 (NFKBIA)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100675651 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4 SNN_linker
Other DBs
NCBI-GeneID: 100675651
NCBI-ProteinID: XP_003408908
UniProt: G3TL58
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAEHPQEWAMDGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAQVLLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTRPTQHLHSILQATN
YNGHTCLHLASIHGYLAIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTPENLQRLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcaacctgccgagcacccccaggagtgggccatggacggccctcgggacgggctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggaactgcgcgagatccgcctggagccgcaggaggcgccg
cgcggagccgagccctggaagcagcagcttacggaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgacgatggaagtgatccgccaagtgaagggagac
ctagccttcctcaactttcagaacaacctgcagcagactccacttcacttggctgtgatc
accaaccagccagaaattgctcaggttcttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgta
ggagttctgacacagacccgtccaacccagcacctccactccatcctgcaggccaccaac
tacaatggtcacacatgtctgcacttggcctctatccatggctatctggccattgtggag
catttggtgtccctgggtgctgacgtcaatgctcaggagccctgtaacggccggaccgcc
ctccaccttgcagtggacctgcagaatcctgacctggtgtcactcttactgaagtgtggg
gctgatgtcaacagagttacctaccagggctactctccataccagctcacctggggccgc
ccaagcacccggatacagcaacagctgggccagctgaccccggaaaacctgcagaggctg
ccagagagtgaagatgaggagagctatgacacggagtcagagttcacagaggatgagctg
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system