KEGG   Loxodonta africana (African savanna elephant): 100675693Help
Entry
100675693         CDS       T04351                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X2
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100675693 (GANC)
   00500 Starch and sucrose metabolism
    100675693 (GANC)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100675693 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100675693
NCBI-ProteinID: XP_003418806
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MEATEKEEISVEDEAVDKNIFKECSNIAFYRRQKQWLSKKSPYRASLDSVTTGKDSTSFQ
IIDEATKIPLLAEVYGLEGNIFRLKINEESPLKPRYEVPSVLTSKPSFVRLISCSGDKGS
LVLADGKGDLKFHVTADPFRVDLVSEEDIVMSINSLGQLYFEHLQIPPKQRATKENEDSA
SVDTSQENQDDMGLWEEKFGNFIDIKANGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTVGIFWLNASETLVEVNTEPRV
EYTLTQMGSVAAKQKVRSRTDVHWMSESGIIDVFLLMGPTPFDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTDGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKEQGFFVKDHEGGDFEGVCWPGLSSYLD
FTNPKVREWYSGLFAFPVYQGSTDILFIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNKSDWSYLKISIP
MLLTLSVTGISFCGADVGGFVGNPEAELLVRWYQAGAYQPFFRGHATMSTKRREPWLFGE
EHTRLIREAIRERYALLPYWYSLVYRAHTTAEPIMRPLWVEFPNELETFGTEDEYMLGSA
LLVHPVTEPKVTVVDVFLPGSDEVWYDSKTFAHWEGARTVKIPVALDTVPVFQRGGSVVP
VKATIGKSTGWMTESPYGLRVALSSKGSAVGELYLDDGHSFQYFHQNRYLHRRFSFCSGV
LINSCADERGHYPSECVVEQILILGLRKQPSSVTTHSSDGKDQPVAFTYSAKTSSLSLEK
LLLKVGADWEVHIR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaccgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagagtgcagcaatattgctttctacaggcgtcagaaacaatggctctccaagaag
tccccctatcgggcgtcgctagactcagtcacaacaggcaaagacagcaccagcttccaa
atcatcgatgaagcaactaagattcccctcctggctgaagtttatggtctggagggaaac
attttcagacttaagatcaatgaagagtctcccctgaagcccaggtatgaagttcccagt
gtcctcacaagcaagccaagctttgtaaggttgatttcatgctcaggggataaaggcagt
ctggtgttggcagatgggaaaggagacctgaagtttcatgtcactgcagacccattcagg
gtagacttggtgtctgaagaagacattgtgatgagcataaactccctgggtcaattatac
tttgagcatttacagattcctcccaaacaaagagctaccaaagaaaatgaggatagtgca
tcagttgacacctctcaggaaaatcaagatgatatgggcctgtgggaggagaaatttgga
aacttcatcgatatcaaagctaatggtcctgcctccattggtttggatttctccttgcac
ggattcgagcatctttatgggattccccaacacgcagaatcacaccaactgaagaatact
ggtgatggcgatgcttaccgtctttataacctggatgtctatggatataagatacacgac
aaaatgggtatttatggctcagtgccttatctcctggcccacaaactgggcagaactgta
ggcattttctggctgaatgcctcagaaacacttgtggaggtcaatacagagcctagagta
gagtacacactgacccagatgggctcagttgcagctaaacaaaaggtcagatctcgaact
gatgtgcactggatgtcggagagtggaatcattgatgtctttctgttgatgggacctaca
ccttttgacgtcttcaaacagtactcacaccttacaggcacacaagccatgccccccctc
ttctccttggggtaccatcagtgccgctggaactacgaggatgagcaggacgtaaaagca
gtggatgcaggatttgatgaacatgacattccttatgacgtcatgtggctggacatagag
cacactgacggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgcaagcttgtggtcatcagtgacccccacatc
aaggttgaccctgactactcagtgtacgctaaggccaaagaacagggcttctttgtgaag
gatcatgaaggcggagactttgaaggggtatgctggcctggtctctcctcttacctggat
ttcaccaatcccaaagtcagagagtggtactctggtctttttgctttccctgtttaccag
gggtctactgacatcctcttcatatggaacgacatgaatgagccctctgtgttcagaggg
ccagagctaaccatgcagaagaatgccatccatcatggcaattgggagcacagagaactt
cacaacatctatggtttttaccagcaaatggctactgcagagggactgatacagcggtca
aaagggaaggagagaccctttgttcttacacgttctttcttcgctgggtcacaaaagtat
ggtgctgtgtggacaggggacaacaagtcagactggagttacctgaaaatttccatcccc
atgttactcactctcagcgttactgggatatctttctgtggagctgatgtaggcgggttc
gtcgggaatccagaggcagagctgctggttcgttggtaccaggccggagcctaccagccc
ttcttccgtggccacgccaccatgagtaccaagcggcgggaaccctggctcttcggggag
gaacacacccggctgatccgagaagccatcagagagcgctacgccctcctgccctattgg
tattctctggtctaccgtgcacacacgactgccgagcccatcatgaggcctctgtgggta
gaattccctaatgaattagagacttttggtacagaagatgaatacatgctgggaagtgct
ttattggttcatccggtcacagaaccaaaagtcactgtggttgatgtgtttctgccggga
tcagatgaggtctggtatgactctaagacatttgcccattgggaaggagcacgcactgtg
aagatcccagtagccttggacactgtcccagtgtttcagcgaggtggaagtgtggtaccg
gtaaaggcaacaataggaaaatccacaggctggatgactgagtccccctatggactccgg
gtagctctaagctctaagggttccgcagttggggagttgtatcttgacgatggacattcc
ttccagtacttccaccagaaccggtacctgcacaggaggttttcattctgttcaggtgtt
ttgatcaacagctgtgccgatgagaggggtcattatcccagcgagtgtgtggtggagcag
atcttgatcctaggcctcaggaagcagccatcttctgtgaccacccactcatctgatggg
aaagatcagcctgtggcttttacatacagtgccaaaacgtcctcgctgagcctggagaag
ctcttgctgaaggtcggcgctgactgggaggtccacatcagatga

DBGET integrated database retrieval system