KEGG   Loxodonta africana (African savanna elephant): 100675762
Entry
100675762         CDS       T04351                                 

Gene name
MRVI1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein MRVI1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100675762 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675762 (MRVI1)
SSDB
Motif
Pfam: MRVI1
Other DBs
NCBI-GeneID: 100675762
NCBI-ProteinID: XP_003412051
LinkDB
Position
Unknown
AA seq 912 aa
MVKAPQSEERLARGGKGNNSILACGAQASRSILGADAAEVLGTHGHSXKEAAMPNVPEEE
EPPGDPQAAQSTASQGPPSAGTSCSPPAIILTGDASSPEGDTDKNLANRAHSPHRRVSHR
HLKVSTASLTSVDPAGHIIDLVNDQLPDISISEEDKKKNLALLEEAKTVSERFLSRRGRK
SRSSPGDSPSAVSPNLSPGPSPASSRSNSLTVPIPPGLDSCSGPQTPLPGAPPQHKEDES
EVSSPHHGESNVPKGLADRKQNDQRKMSQGRLAPRSPTVEKSKETAVEQKENFDPLQHPE
TTPKVPAPGTGSVGKTALNSPQPGPVESELGKQLQKTAREGDPLLRSPALGSGGAVPLSP
QGKGSSGELTGPKATSKADLRPLASRPPLQRGVSWDSGPEEISPRLQKVLAKLPLAEEEK
RFSGKASSKLAKVPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQ
EKGLPSELSPAIEEEESKSGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENVFVQL
SLAFRNDSYTLESRISQAERERNLTEENTEKELENFKASLMSSASLWHHCEHRETYQKLL
EDIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKL
ANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQSPGSSPIP
SLPALSESTNGKGNLPVTSALPVLLENGKTNGDPDCEASASIPTPSCLEEISQETKARIE
EEAYNKGYQEGLKKTKELQDLKEEEEEQKSESPEEPEDAEETDEEKKDQKSSKLEELVHF
LQVMYPKLCQHWQVIWMMAAAMLVLTIVLGLYNSYNSCVEQADGPLGRATCSAAQRDSWW
SSGLQHEQPTEQ
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggtaaaagctccccagagtgaagagaggctggccagaggaggaaaggggaataactca
attttagcctgcggcgcccaggcctctcggagcattcttggggctgacgcagcagaggtt
ctgggcacacacggccactctngcaaggaggctgccatgcccaacgttcctgaggaggag
gagccccccggagatcctcaggcagcccagagcacagccagccaaggccctccctcagca
ggaacatcttgcagtccacctgcaatcatccttactggggatgccagctcaccagaagga
gatactgacaaaaacctggccaacagagctcatagtccgcacaggagggtttctcaccga
cacctgaaggtttccacagcttcactgacttctgtggaccctgcagggcacatcattgat
ctggtaaatgaccagctgccggatatcagcatctccgaggaggacaagaagaaaaacctg
gcactgctggaagaagccaagacagtgagtgagcgattcctgtctcgccgagggaggaag
tccagaagcagcccaggagactccccgtcagctgtttccccgaacctcagccccggacct
tcccctgcatcctctcggagcaactcgcttacagtccccatccctccaggtttggattca
tgcagtggcccacagacccctctacctggagcaccaccacagcacaaggaggatgagtct
gaagtctcttcacctcaccatggcgagtctaatgttcccaaagggctagctgaccggaag
cagaatgaccagaggaaaatgtcgcagggcaggctggctcctcgctcccccacggttgaa
aagtccaaagagactgcagtagaacaaaaggaaaacttcgatccccttcagcaccccgag
accacacccaaggtcccagctcctggcacaggcagtgtcgggaaaacggccctgaacagc
ccccagccaggccctgtggagagcgagctgggaaagcagctccagaagacagccagggag
ggtgaccctctgctgagaagcccagccctgggctctggaggggcagtccccctatcccct
caggggaaaggctcatctggggagctgacagggcccaaggctacatccaaagctgatttg
cggcccttggcctcccggccccccctgcagcggggggtctcctgggacagtggccctgaa
gaaatcagcccccggctgcagaaagtgcttgccaagctgccactggcagaggaagagaag
cgtttttcagggaaagccagcagcaagctggccaaagtgcctgggctcaaagactttcag
atacaagtgcagcccgtgaggatgcagaaactgaccaaactgcgtgaggagcacatcctg
atgagaaatcagaacttagtggggctcaagcttccagaccttagtgaagcggctgagcaa
gaaaaagggctcccttctgaactctcccctgctattgaggaggaagagtcaaagagtggc
ttggatgtcatgcccaatatttctgacgtgctgctgcgcaaactgagggtccacaagtct
ctccctggaagtgcccctccactcactgaaaaggaagttgagaacgtgtttgtacaactg
tccttggcctttagaaatgacagctacaccctggaatctagaattagccaggctgaaagg
gaacggaacctgacagaggagaacacggagaaggaattggaaaacttcaaagcttccctt
atgtcttcagcttcactctggcaccactgtgagcaccgggagacctaccagaagctgctg
gaggacatcgctgtcctgcaccgcctggctgcccgcctctccagccgagctgagatggtg
ggggctgtccgccaggaaaagcgcatgtccaaagccacagaagtgatgatgcagtatgtg
gagaacctgaagaggacgtacgagaaagaccatgcagagctcatggagtttaaaaaactt
gcaaatcagaattcaagccgcagctgtggcccctctgaagatggggtccctcgcacagcg
cggtccatgtcccttacgctgggaaagaacatgccccgccggagggtcagcgtagctgtg
gttcccaagtttaatgccctcaacctgccaggccaatctcctggctcatcacccatcccc
tccttaccagccctgtcggaatcaaccaatgggaaaggcaacctacctgtcacctcagca
ctgcccgtacttttggaaaacggaaagacaaatggagacccagattgtgaagcctctgct
tccatcccgaccccaagttgcctggaggagattagccaggagaccaaggccaggatagag
gaagaagcttataacaagggataccaggagggcctaaagaagactaaggaacttcaagac
ctgaaggaggaggaggaagaacagaagagtgagagtcctgaggaacctgaagatgcagaa
gaaaccgatgaagagaaaaaggaccagaaaagcagcaaacttgaagagttggttcatttc
ttgcaagtcatgtatcccaaactgtgtcagcactggcaagtaatctggatgatggctgca
gcgatgctggtcttgactattgtgctggggctctacaattcatataactcttgtgtggag
caggctgatggcccccttggaagagcaacttgctcagcagcccagagggactcctggtgg
agctcaggactccagcatgagcagcccacagagcaataa

DBGET integrated database retrieval system