KEGG   Loxodonta africana (African savanna elephant): 100675856
Entry
100675856         CDS       T04351                                 

Gene name
CST3
Definition
(RefSeq) cystatin-C
  KO
K13899  cystatin-C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100675856 (CST3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100675856 (CST3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100675856 (CST3)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I25: cystatin family
   100675856 (CST3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100675856 (CST3)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 100675856
NCBI-ProteinID: XP_003411668
LinkDB
Position
Unknown
AA seq 146 aa
MAAPLRAPLFLLAALALAVMLSSAGAASPARPPRLLGGIMDADENEEGVQRALDFAISEY
NKASNDKFHSRVVQVVRARKQIVSGVNYFLDVEIGRTTCTKSQPNLANCPFHDQPQLKKK
ALCSFQIYTVPWLGTTSLTKSSCQDA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccgcgcccctgcgcgccccgctcttcctgttggccgccctggccctggccgtgatg
ctgagctcggcgggcgccgcgagccccgccaggcccccgcgcctgctgggcggcatcatg
gacgcagacgagaacgaggagggcgtgcagcgcgccctggacttcgccatcagcgagtac
aacaaggcgagcaacgacaagttccacagccgcgtggtgcaggtggtgcgcgcccgcaag
cagatcgtgtctggggtgaactacttcctggatgtggagattggacgaaccacatgtacc
aagtcccagcccaacttggccaactgtcccttccatgaccagccacaactgaagaagaaa
gccctctgctctttccagatatatactgttccttggctgggcacaacctccctgacgaaa
tccagctgccaggacgcatag

DBGET integrated database retrieval system