KEGG   Loxodonta africana (African savanna elephant): 100675899
Entry
100675899         CDS       T04351                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor isoform X2
  KO
K08523  heparin-binding EGF-like growth factor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100675899 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675899 (HBEGF)
   04915 Estrogen signaling pathway
    100675899 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    100675899 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100675899 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    100675899 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100675899 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100675899 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100675899 (HBEGF)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100675899 (HBEGF)
SSDB
Motif
Pfam: EGF Ninjurin
Other DBs
NCBI-GeneID: 100675899
NCBI-ProteinID: XP_003404583
UniProt: G3T245
LinkDB
Position
Unknown
AA seq 208 aa
MKLLPSVVLKLLLATVLSALVTGESLERIRRGVAAGTRKPDPPTGSTDQLLPSGDARSRE
VLDLDEANLDLFRVAFSSKPQAQATPSKEEYGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CRYVKKLRAPSCLCQPGYHGERCHGLTLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYNVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctactgccgtcggtggtgctgaagctcctcctggctacagtgctctcagcgttg
gtaaccggtgagagcctggagcgaattcggagaggggtggcggccggaacccgcaaacca
gaccctcccactggatccactgaccagctcctgccctccggagatgcccggagccgagag
gtcctggacttggatgaggcaaacctggaccttttcagagttgctttctcctccaagccg
caagctcaggccacaccaagcaaggaggaatatgggaaaagaaagaagaagggcaagggg
ctagggaagaagagagacccttgtcttcgaaaatacaaggacttctgcatccatggagaa
tgcagatatgtgaagaagctgcgggctccatcttgcctctgccagccaggttaccatgga
gagaggtgccatgggctgaccctcccagtggaaaaccgcttgtattcgtatgaccacaca
accatcctggccgtggtagctgtggtactgtcttctgtctgtctgctcgtcattgtgggg
cttctaatgtttaggtaccataggagaggaggctacaatgtggaaaatgaagagaaggtg
aagttggggatgactaattcccattga

DBGET integrated database retrieval system