KEGG   Loxodonta africana (African savanna elephant): 100675913
Entry
100675913         CDS       T04351                                 

Gene name
IFIH1
Definition
(RefSeq) interferon-induced helicase C domain-containing protein 1 isoform X1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04622  RIG-I-like receptor signaling pathway
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100675913 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100675913 (IFIH1)
   05171 Coronavirus disease - COVID-19
    100675913 (IFIH1)
   05164 Influenza A
    100675913 (IFIH1)
   05162 Measles
    100675913 (IFIH1)
   05168 Herpes simplex virus 1 infection
    100675913 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:lav04054]
    100675913 (IFIH1)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100675913 (IFIH1)
Pattern recognition receptors [BR:lav04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100675913 (IFIH1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD ResIII Helicase_C DEAD CARD SWI2_SNF2 AAA_22 AAA_19 DUF3638
Other DBs
NCBI-GeneID: 100675913
NCBI-ProteinID: XP_003405875
LinkDB
Position
Unknown
AA seq 1025 aa
MSNGCSLDKSFRYLISCFRVRLKMYIQVEPVLDYLTFLPADLKEQIQKTAATTGNIHAVE
LLLSNLEKGSWPLGWTREFMEALQQAGNPLAARYMNPDLTDLPSPSSENAHDECLQLLNL
LQPTLVDKLLVRDVLDECVANNLLTTEDRSRISAAENHGNESGVRELLKRIVQKDNWFST
FLTILNQTGNNNLVLELTGTSSFESNAEIENLSQRNGPEPKEPLLPATDQPSSEYEHWDM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENEMRRA
SPEPELHLRSYQMEVAKPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKSSEPGKVI
VLVNKVPLVEQLFRKEFKPFLKKWYRTMGLSGDTQLKISFPEVVKSCDVIISTAQILENS
LLNSEKGEDAGVQLSDFSLIVIDECHHTNKEAVYNNIMRRYLEQKLKNNRLKKQNKPVIP
LPQILGLTASPGVGGARKQAKADEHILKICANLDASTIKTVKENVGELREHIKEPCKKFA
IADDTREDPFKEKLLEIMTKIQTFCQMNPMSDFGTQPYEQWAIQTEKKAAREGNRKDRVC
AEHLRKYNEALQINDTIRMIDAYNHLETFYNDEKDKKFAVLEDDSDESGDSGDDDGGKDE
DAEKKPLKLHGTDRFLMTLFFDNRRILKKLAENPQHENEKLEKLRNTIMEQYTRTEGSAR
GIIFTKTRQSAFALSQWITENDKFAEVGVKAHHLIGAGHSSEFTHMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYILVAPSSSGV
VEREIVNDFREKMMYKAIDRVQNMKPEDYDHKILELQMQSIMEKKMKIKRSITKHYRDNP
SLITFLCKNCSVLVCSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKFADYQTNGEI
ICKCGQAWGTMMVHKGLDLPCLKIKNFVVVFKNKAPKKQYKKWVELPITFPDLDYSECCL
FSDED
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgtcgaatgggtgttccttagacaagagtttccggtatctcatctcgtgcttcagggtc
agactgaaaatgtacatccaggtggagccagtgctggactacctgacattcctgccagca
gaccttaaggagcagattcagaagacggctgccaccaccgggaacatacacgcagttgaa
ctgcttttgagcaacttggagaaggggtcctggcccctgggctggactagggaatttatg
gaggccctccagcaagcgggcaaccctttagccgcccgctacatgaaccctgacctcacc
gatctgccctcgccgtcatctgagaacgctcacgatgagtgtctccaactgctgaacctc
cttcagcccactctggtggacaagcttctggttagagatgtactggatgaatgcgtggca
aataacctgttgacaactgaagacagaagtaggatttctgctgcagaaaaccatggaaat
gaatcaggtgtaagggagctactgaaaaggatcgtgcagaaagacaactggttttctaca
tttctgacgattctgaatcaaacaggaaacaacaaccttgtcctagagttaacaggcacc
agtagctttgaaagcaatgcagagattgagaatttatcacagagaaatggtcctgaacct
aaagagccacttcttcctgccacagatcagccaagttccgagtacgagcactgggacatg
gagaataattcatcagaatcgtcttttgcagattcttctgtagtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaatgagatgagaagagca
tcccctgagcctgagctgcatctcaggtcttaccaaatggaagttgccaagccagcctta
gaagggaagaatatcatcatctgcctccctacagggagtgggaaaaccagagtggctgtg
tacattgccaaggatcacttggacaagaagaaaaaatcatctgaacctggaaaagttatc
gtccttgtcaataaggtacctttagttgaacaactattccgcaaagagttcaaaccattt
ttgaagaaatggtatcgtactatgggattaagtggtgatactcaactgaaaatatcattt
ccagaagttgtcaaatcctgcgatgttattatcagcacagctcaaattcttgaaaactcc
cttttaaattcagaaaaaggagaagatgctggtgtccagttgtcagacttttccctcatc
gtcattgatgaatgccatcacaccaacaaagaagcagtctataataacatcatgaggcgc
tatttggaacagaagttgaaaaataatagactcaaaaaacaaaacaaaccagtcattcct
ctacctcagatactaggattaactgcttcacctggtgttggaggggccagaaaacaagcc
aaagctgacgaacacattttaaaaatatgtgccaatcttgatgcatctaccattaaaact
gtgaaagaaaatgttggtgaactcagggaacacataaaggagccttgcaagaagtttgca
attgcagatgacaccagagaagacccatttaaagagaaacttttagaaataatgacaaag
attcaaactttttgccaaatgaatccaatgtcagattttggaacccaaccctatgaacaa
tgggccattcaaacggaaaaaaaagctgcaagagaaggaaatcgcaaagaccgtgtttgt
gcagagcatttgagaaagtacaatgaggccctacaaattaatgacacaatccgaatgatc
gacgcatataatcatcttgaaactttctataatgacgagaaagacaagaagtttgcagtc
ctagaagatgatagtgatgagagtggtgacagtggtgatgatgatggtggcaaagatgaa
gatgctgaaaagaagcctttgaaactgcatgggacagatagatttcttatgactttattt
tttgacaacaggagaatattgaaaaagttggctgaaaacccacaacatgaaaatgaaaaa
ctggagaaattaagaaacaccataatggaacaatatactaggactgagggatcagccagg
ggaatcatttttacaaaaacacgacagagtgcatttgccctttcccagtggatcactgaa
aacgacaaatttgcagaagtcggagtcaaagcccaccacctaattggagctggacacagc
agcgagttcacgcacatgacacagaatgaacaaaaagaagtcattagtaaatttcgcact
ggaaaaataaatctgcttatcgcgaccacagtggcagaagaaggtctggatatcaaagaa
tgcaatatcgtcatccgctatggtctcgtcactaacgaaatagccatggtccaggcccgt
ggtcgagcaagagctgatgaaagcacctacatccttgttgcccccagcagttcaggagtt
gttgaacgtgaaatagttaatgatttccgagagaaaatgatgtataaagctatagaccgt
gttcagaatatgaaaccagaggattatgatcataagattttggaattacagatgcaaagt
ataatggaaaaaaaaatgaaaatcaagagaagtatcacaaagcattacagggataatcca
tcattaataactttcctctgcaaaaactgcagcgtgctagtgtgctctggagaggacatt
cacgtaattgagaagatgcatcatgtcaatatgacaccggaattcaaggaactctacatt
gtgagagaaaacaaagcattgcaaaaaaagtttgccgactatcaaacaaatggtgagatt
atctgcaagtgtggccaagcttggggaacgatgatggtgcacaaaggtttagatttacct
tgtctgaagataaagaattttgtggtcgttttcaaaaacaaagcacctaagaaacaatac
aagaaatgggtagaattacctatcacatttcctgaccttgactattcagagtgttgtttg
ttcagcgatgaagattaa

DBGET integrated database retrieval system