KEGG   Loxodonta africana (African savanna elephant): 100675937
Entry
100675937         CDS       T04351                                 

Gene name
DAG1
Definition
(RefSeq) dystroglycan
  KO
K06265  dystroglycan 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04512  ECM-receptor interaction
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100675937 (DAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100675937 (DAG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100675937 (DAG1)
   05414 Dilated cardiomyopathy
    100675937 (DAG1)
   05416 Viral myocarditis
    100675937 (DAG1)
SSDB
Motif
Pfam: DAG1 a_DG1_N2 He_PIG ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 100675937
NCBI-ProteinID: XP_003409702
UniProt: G3T6Q9
LinkDB
Position
Unknown
AA seq 893 aa
MSGSLLLLPPLWGRTFLLLLLVALAQSRWPSEPSETVRDWENQLEASMHSVLSDLREAVP
TVVGIPDGMAVVGRSFRVTIPTDLIASSGEVIKVSAAGKETLPSWLHWDPKSHALEGLPL
DTDKGVHYISVSAARLGSNGSHIPQTSSVFSIEVYPEDHSEPQSVRAASPEPGEVVASTC
AADEPVTVLTVILDADLTKMTPKQRIDLLHSMQSFSGVELHNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWRLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIANK
KPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPV
PGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTMVSGQIRPTMTIPGYVEPTAVATPPTT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPPLRATTKVPITRLETASPPTRIRT
TTSGVPQGGEPNQPPELKNHIDRVDAWVGTYFEVKIPPDTFYDKEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSTSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
RAPARFSAKFVGDPAPVVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNN
TLPLEPCPKEQITGLSRRIAEDDGKPRPAFSNALEPDFKAMNVAVMGSGSCRHLQFIPVT
SPRKVPSETPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDAVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgtctgggagcctcttgctgctgcccccactctgggggaggacctttctcctcctgctc
ttggtggcattggctcagtcccgctggcccagtgaaccctcggagaccgtcagggattgg
gagaaccagcttgaggcgtccatgcactcggtgctctcagacctccgtgaggctgttccc
acagtggttggcattcctgatggcatggctgttgttggacgctcatttcgagtaaccatt
ccaacagatttaattgcatccagtggagaagtcatcaaggtatcagcggcagggaaggag
accctgccgtcctggctgcactgggacccgaaaagccatgccctggagggccttcccctc
gacactgacaagggtgtgcactacatctcggtgagtgctgcacggctggggtccaacggg
agccacatcccccagacctccagcgtgttctccattgaggtctaccctgaagaccacagt
gagccgcagtccgtgcgggcggcatcaccagaacctggtgaggtggtggcatctacctgt
gctgccgatgagcctgtgactgtcctgacggtgattctggatgccgacctcaccaagatg
accccaaagcaaaggattgacctcctgcacagcatgcagagcttctcgggagtggagctt
cacaacatgaagttggtgccagtggtcaataacagactgtttgacatgtcggcctttatg
gctggcccaggaaatgcaaaaaaggtggtggaaaatggggctctgctctcctggaggctg
ggctgttccctgaaccaaaacagtgtgcctgacatacgtggtgtggaggcccctgccagg
gagggcgccatgtccgctcagcttggctaccctgtggtgggttggcacatcgccaacaag
aagccccctctccccaaacgcatccggaggcagatccatgccacacccacccctgtcact
gccattgggcccccaaccacggccatccaggagccaccctccaggatcgtgcctaccccc
acatctccagctatcgctccaccgacagagaccatggctcctccagtcagggatcctgtt
cctgggaagcccacagtcaccattaggactcgaggtgcaatcattcagaccccaacccta
ggccccatccagcctactcgagtgtcagaagctggcaccatggtttctggccagatccgc
ccaacgatgaccattcctggctatgtggagcccacggcggttgctacccctcccacaacc
accactaagaagccacgagtatccaccccaaaaccagccacgccttcaactgactcctca
acaactacaactcgcaggccaaccaagaagccgcggacaccccgaccaccactccgggcc
accaccaaagttcccatcaccagattggaaacagcctccccacccactcgcatccgtacc
accaccagtggggtgccccaggggggagagcccaaccagcccccagagctcaagaaccac
attgacagggtagatgcctgggttggtacctactttgaggtgaaaatcccaccagacaca
ttctacgacaaggaggacaccaccaccgacaagctgaagctgaccctgaagctgcgggag
cagcagctagtgggtgagaagtcctgggtacagttcaacagcaccagccagctcatgtac
ggcctgcctgacagcagccacgtgggcaagcatgagtatttcatgcatgccacagacaag
gggggcctctcagctgtggatgccttcgagatccacgtccacaagcgccctcaaggggac
agggctcctgcacggttcagtgccaaatttgtgggcgacccagcaccagtggtgaatgat
atccacaagaagattgccctggtgaagaagctggcctttgcctttggggaccgcaactgc
agcaccatcaccctgcagaatatcacccggggttccattgtggtggaatggacaaacaac
acactgcccctggagccctgccccaaggagcagatcacagggctgagccgaaggatcgcc
gaggatgacgggaaaccacggccggccttctccaacgctctggagcccgactttaaggcc
atgaatgttgctgtgatgggctcaggcagctgccggcacctgcagtttatccctgtgact
tcacccaggaaggtgccttcagagacaccgcccacagaggtgccagacagggaccctgag
aagagcagtgaggatgatgtctacctgcacacagtcattccagctgtggtggtcgcagcc
atcctgctcatcgccggcatcattgcaatgatctgctaccgcaagaagcggaagggcaag
ctcacactggaggaccaggccaccttcatcaagaaaggggtgcccatcatctttgcggac
gaactggatgactccaagcccccaccctcctccagcatgccactcatcctgcaggaggag
aaagcccccctgccccctcccgagtaccccaaccagagcgtgcccgagaccactcctctg
aaccaggacgccgtgggagaatatacacccctgcgggatgaggatcccaatgcacctccc
taccagcctcctccacccttcacagctcccatggagggcaagggctcccgtcccaagaac
atgaccccataccggtcgccccctccctatgttcccccttaa

DBGET integrated database retrieval system