KEGG   Loxodonta africana (African savanna elephant): 100676090
Entry
100676090         CDS       T04351                                 

Gene name
CALD1
Definition
(RefSeq) caldesmon isoform X2
  KO
K12327  caldesmon
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100676090 (CALD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100676090 (CALD1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100676090 (CALD1)
SSDB
Motif
Pfam: Caldesmon
Other DBs
NCBI-GeneID: 100676090
NCBI-ProteinID: XP_010598743
LinkDB
Position
Unknown
AA seq 535 aa
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEEALG
QVTDQVEVNAQNSVPAEEAKTTTPNTQGEGDDEAALLERLARREERRQKRLQEALERQKE
FDPTITDAGLSLPSRRMENNTAENETAEKEEKSESRQERYEIEETEIITKSYQKNDWRDA
EEKKEEKEKEEEEEEKPKQGSIEENQVKDEKIKKDKEPKEVKSILDRKKGFTEVKTQNGE
FMTHKLKHTENTFSRSGGRPSRRPRRPKAASQVEAGQRLEELRRRRGETESEEFEKLKQK
QQEAALELEELKKKREERRKVLEEEEQKKKQEEAERKVREEEEKRRLKEEIERRRAEAAE
KRQKMPEDSVSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSGVKSTHQAAVVSKIDSR
LEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKTMWEKGKVFSSPTASGTPNKETAGL
KVGVSSRINEWLTKTPDGSKSPAPKPSDLRPGDVSGKRNLWEKQSVDKVTSPTKV
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggatgactttgaacgtcgcagagaacttaggaggcaaaagcgggaagagatgcgcctg
gaagcagaaagaatcgcctaccagaggaacgatgatgacgaggaagaggctgcccgagaa
aggcgccgccgagcccggcaggaaaggctgcggcagaagcaagaggaagaagccttgggg
caggtgacagaccaggtggaggtgaatgcccagaacagcgtgcctgctgaggaggccaag
acaaccaccccaaacactcagggggagggcgatgatgaagctgccctcctggagcgcctg
gctcggcgggaggaaagacgccaaaaacgcctccaggaagctctggagcggcagaaggag
tttgacccgaccatcacagatgcaggtttgtcactaccaagcagaagaatggaaaacaac
acggcagagaatgagaccgcagagaaggaagagaaaagtgagagtcgccaagaaagatat
gagatagaggaaacagagatcatcacaaagtcctaccagaagaatgattggagggatgcc
gaagagaagaaagaagaaaaggaaaaggaggaagaggaagaagagaagccaaagcaagga
agcattgaagaaaatcaggtcaaagatgagaagattaaaaaagacaaagagcccaaagaa
gtgaagagcatcttggatcggaagaagggattcacagaagtcaagacacagaatggggaa
ttcatgactcacaaacttaaacacaccgagaacactttcagccgcagcggaggaaggccg
agccggaggccaaggaggccgaaggctgcctcccaggtggaggctggccagcgcctggag
gagctccgacgccggcgtggggagacggagagcgaggagttcgagaagctcaaacagaag
caacaagaggcagccctggagctggaggagctgaaaaagaagagggaggagcggagaaag
gtcctggaggaggaagagcagaagaaaaagcaggaggaggcggagcgcaaagtccgagag
gaggaagagaagaggaggctaaaggaagagattgaaaggcgaagagccgaagctgctgag
aagcgccagaagatgccggaagacagtgtgtccgatgacaagaaaccatttaagtgtttc
actcccaaaggttcttctctcaagatagaagagcgagcagaatttttgaataagtctgtg
cagaaaagcggtgtcaaatcaactcatcaagccgcagtagtctccaagattgacagcaga
ctggagcagtataccagtgcaatcgagggaacgaaatctgcaaaacctacgaaaccagcc
gcctcggatcttcctgtcccggctgagggtgtacgcaatatcaagaccatgtgggagaag
gggaaagtgttttcatcccccaccgcgtcaggcaccccaaataaggaaacagctggcttg
aaggtgggggtgtccagccgcatcaatgaatggctaaccaaaaccccagatgggagcaag
tcgccagctcccaaaccttctgacttgaggccaggagatgtatccggcaagaggaacctc
tgggaaaagcagtctgtggataaggtcacctctcccactaaggtttga

DBGET integrated database retrieval system