KEGG   Loxodonta africana (African savanna elephant): 100676111Help
Entry
100676111         CDS       T04351                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00030  Pentose phosphate pathway
lav00051  Fructose and mannose metabolism
lav00052  Galactose metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav01230  Biosynthesis of amino acids
lav03018  RNA degradation
lav04152  AMPK signaling pathway
lav05230  Central carbon metabolism in cancer
Module
lav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100676111 (PFKM)
   00030 Pentose phosphate pathway
    100676111 (PFKM)
   00051 Fructose and mannose metabolism
    100676111 (PFKM)
   00052 Galactose metabolism
    100676111 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100676111 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100676111 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100676111 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100676111 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100676111 (PFKM)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100676111 (PFKM)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100676111 (PFKM)
Messenger RNA biogenesis [BR:lav03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100676111 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100676111
NCBI-ProteinID: XP_010594468
UniProt: G3T4T2
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLRKAGKITEEEAKKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRNRGSRLNIIIVAEGAIDRNGEPITSENIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTR
AMQEKKFDEAIKLRGRSFMNNWEVYKLLAHIRPPVTKGFAHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVF
QPVTELQEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEASV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccatcgccgtt
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatctttaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagatcacatcagggaagccacctgggagagcgtttcgatgatgcttcagctggga
ggcacagtgattggaagtgcccgatgcaaggactttcgggagcgagagggacgactccga
gctgcccacaacctggtgaagcgtgggatcaccaacctgtgtgtcattgggggtgatggc
agtctcactggggctgacaccttccgttctgagtggagtgacttgttgagtgatctccgg
aaagcaggtaagatcacagaagaagaggctaagaagtccagctacctgaacattgtgggt
ctcgttggctctattgacaatgacttctgtggtactgacatgaccattggcactgactct
gccctgcaccggatcatagagattgtagatgccatcactaccactgctcagagccaccag
cggacgtttgtgctagaagtgatgggccggcactgtggatacctggcccttgtcacctct
ctctcctgtggggccgactgggtctttattcctgaatgtccaccagatgatgactgggaa
gaacacctttgccgccgtctcagcgagacaaggaaccgtggttctcgtctcaacattatc
attgtggctgaaggtgcaattgacaggaatggggaaccaatcacctcagaaaacatcaag
aatctggtggtaaagcgtctgggatatgacacccgggtcactgttttgggacatgtgcaa
cgaggtgggacaccatcagccttcgaccggatcctgggtagccggatgggtgtggaagca
gtgatggcacttttagagggaactccagacaccccagcctgtgtggtgagcctctctggt
aaccaggccgtgcgcctgccccttatggagtgtgtccaggtgaccaaggatgtgaccagg
gccatgcaagagaagaaatttgatgaagcgataaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcacatcagacctccagtgactaagggttttgca
cacaccgtggcagtgatgaatgtgggggccccagctgcaggcatgaatgctgccgtccgc
tccactgtgagaattggcctcatccagggcaaccgcgtgctggttgtgcatgatggcttt
gagggcctggccaagggtcagattgaagaagctggctggagctatgttgggggctggact
gggcaaggtggttccaaacttgggaccaaaaggactctacccaagaagagctttgagcag
atcagtgccaacataacaaagtttaacattcagggcctagtcatcattgggggctttgag
gcttacactgggggcctggagctgatggagggcaggaagcagtttgatgagctctgtatc
ccgtttgtggtcattcctgctacagtctccaacaacgtccctggctcagacttcagcgtt
ggggctgacacagccctcaatactatttgcatgacctgtgatcgcattaagcagtcagcg
gcaggcaccaaacgacgggtgtttatcattgagacgatgggtggctactgtggctacctg
gccaccatggcaggacttgcagctggggctgatgcagcctacatttttgaggaccccttc
accattcgagacctacaggccaatgttgagcatctggtgcaaaagatgaaaacgactgtg
aaaaggggcctggtgttaaggaatgagaagtgcaatgagaactataccactgacttcatt
ttcaatctgtactctgaggagggaaagggcatcttcgatagcaggaagaatgtgcttggc
cacatgcagcagggtgggagcccaaccccgtttgacaggaattttgccactaagatggga
gccaaggctatgaactggatgtctgggaaaatcaaagagagttatcgtaatgggcggatc
tttgccaacagtccagactcaggctgtgttctgggaatgcgtaagagggctctggtcttt
caaccagtgactgagctgcaggagcaaacagatttcgagcatcgcatccccaaggaacag
tggtggctgaagctgaggcccatcctgaagatcttagccaagtacgagatcgacctggac
acctccgatcatgcccacctggagcacatcagccggaagcggtctggggaagcgtctgtc
tga

DBGET integrated database retrieval system