KEGG   Loxodonta africana (African savanna elephant): 100676198
Entry
100676198         CDS       T04351                                 

Gene name
GCG
Definition
(RefSeq) glucagon
  KO
K05259  glucagon
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04714  Thermogenesis
lav04911  Insulin secretion
lav04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100676198 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676198 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100676198 (GCG)
   04922 Glucagon signaling pathway
    100676198 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    100676198 (GCG)
SSDB
Motif
Pfam: Hormone_2 Lipoprotein_10 MPM1
Other DBs
NCBI-GeneID: 100676198
NCBI-ProteinID: XP_003405876
LinkDB
Position
Unknown
AA seq 179 aa
MRSIYVVAGLFIMLIQGSWQRSLQDTEEKPRSFSASQTDPPNDPDQMIEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRQDKFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVIVEELRRRHADGSFSDEMNTVLDNLATRDFINWLLQTKITDRK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgagaagcatttacgttgtggctgggttgtttataatgctgatacaaggcagctggcaa
cgttcccttcaagacacagaggagaaacccagatcattctcagcttcccagacagatccg
cccaacgatccggatcaaatgattgaagacaagcgccattcacagggcacattcaccagt
gactacagcaagtacttagactccaggcgtgctcaggattttgtgcagtggttgatgaac
accaagaggaacaggaataacattgccaaacgtcaggataaatttgagagacatgctgaa
gggacctttaccagtgatgttagttcttatttggaaggccaagctgccaaggaattcatt
gcttggctggtgaaaggccgaggaaggcgagatttcccagaagaagtcatcgttgaagag
ctccgccgcagacacgctgatgggtctttctctgacgagatgaacacagttcttgataat
cttgccaccagagattttataaattggttgcttcagacaaaaattactgacaggaaataa

DBGET integrated database retrieval system