KEGG   Loxodonta africana (African savanna elephant): 100676312
Entry
100676312         CDS       T04351                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100676312 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100676312 (TERT)
   05226 Gastric cancer
    100676312 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676312 (TERT)
   05165 Human papillomavirus infection
    100676312 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100676312 (TERT)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     100676312 (TERT)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    100676312 (TERT)
   Telomerase complex (fungi)
    100676312 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1 PDEase_II
Other DBs
NCBI-GeneID: 100676312
NCBI-ProteinID: XP_023401395
LinkDB
Position
Unknown
AA seq 1098 aa
MPRAPRCRAVRALLRGRYREVLPLATFAQRLGAEGRRLVRRGDPAAFRSLVAQCLVCVPW
GAPPPPTAPSFRQVSCLKELVARVVQRLCERGAKNVLAFGFALLDEARGGPPMAFTTSVR
SYLPNTVTDTLRGSGAWGLLLQRVGDDVLAHLLARCSLYLLVAPSCAYQVCGLPLYELCA
RDTRGPEPGCGAPRRTVGGTRRRWDSAGERHPLAKRSRHSLALEPGQVPQSWAHLDRACG
QSDSDPHAVTPGRRAAAKAVSWEGEIAGRRRSSTLGVKERGAGPSSAQPPLSLLPQAYVE
TKRFLYCLGAKERLPSTFLLSSLQGNLTGARRLVETIFLRTKPAWRKTQLRRLTPRYWRM
RPLFQELLGNHARCPYSVLLRTHCPRLGSAMATPAGTGGAGTGTPEQPPGPAVKPAPEED
AGLQCVVQLLRQHSSPWQVYTFVRACLHRLVPPGLWGSSHNKCRFLRNVKMFISLGKHAK
LSLQELMWKMKVQDCEWLRRSPGDYAVPASEHRLREEILAKFLFWLMDTFVVGLLRAFFY
VTETMFQKNRLFFFRKSVWNKLQSIGIRQHFNKVRLRELSEAEVQRRQQTKPSLLTSKLR
FVPKAHGLRPIVNMDYVVGARTFRREKKRLQHFNSQMKNLFSVLNYERAVRPGLLGASVL
GIDDVYKAWRAFVQQVRAGDPRPQLYFVKVDVTGAYDAIPHNKLVEVIANVIKPKENIYC
IRRYAVVQKTAQGYIRKSFKRHVSTLADLLPYMKQFVEHLQETSSLKNAVVIEQSSSLNE
PASSLFDFFLHLVHNNVIKIRGKYYVQCQGIPQGSILSTLLCSFCYGDMENKLFSGIQED
GLLLRLVDDFLLVTPHLTQAKAFLSTLVRGVPEYGCMINLRKTVVNFPVDDGPGQATILQ
LPAHCLFPWCGLLLDTRTLEVFCDYSSYARTSIKASLVFNHGFKAGRNMRRKLFAVLRLK
CHGLFLDLQVNSLQTVYINVYKIFLLQAYRFHACVLQLPFNQQVGKNPSFFLRVISDTAL
RCYSILKAKNAGTRGVQWLRGTEPQAPCGFRGSPTELVRWELPLHKAISHCLPAHSSAEC
LWARGRHCWCEQHPPSWR
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgccgcgcgcgccccgttgccgggcggtgcgcgccttgttgcgcggtcgctaccgcgag
gtgctgccgctggcgacgttcgcgcagcgcctgggggccgagggccggcgactggtgcgg
cgcggggaccctgcggccttccgctcgctggtggcccagtgcctggtgtgcgtgccttgg
ggtgcgccgccgccccctacggccccttcctttcgccaggtgtcttgcctgaaggagctg
gtggccagggtcgtgcagcggctctgcgagcgcggcgcgaagaatgtgctggccttcggc
ttcgcgctgctggacgaggcccgcggcggcccgcccatggccttcacgactagcgtgcgc
agctacctgcccaacacggtcactgacacgctgcgtggcagcggcgcctgggggctgctg
ctgcagcgcgtgggcgatgacgtgctggcccacctcctggcgcgctgctcgctctacctt
ctggtggccccgagctgcgcttaccaggtgtgcgggctgccgctctacgagctctgcgcg
cgagacaccagggggccggagccgggctgcggggccccgcgaagaaccgtggggggcacg
aggcggcgttgggacagcgcgggtgagcggcacccattggctaagagatccaggcacagc
ctagccctggagccagggcaggtaccacagtcctgggcccacctggatagggcatgtggg
cagagtgacagcgatccccacgcggtgacacctggcaggagagccgccgcgaaagccgtg
tcttgggagggtgaaattgctggaaggcgtcgttcttccacgctgggggtcaaggagcgt
ggggcaggcccctcgtccgcgcagccgccactgtcactgcttccccaggcatacgtggag
accaagcgctttctctactgcctgggggccaaggagaggctgccaagcacctttctcctc
agttccctgcagggcaatctgactggggcccgaaggctagtggagactatctttctgcgc
acgaagccggcgtggagaaagacgcagctgcggcgcctgaccccgcgctattggcgaatg
cggcccctgttccaggagctgcttgggaaccacgcgcggtgtccctacagcgtgcttctc
aggacgcactgcccgaggctgggctcggccatggccacccctgcgggtactggcggggcg
ggtactgggaccccggagcagcccccggggcctgcagtgaagcctgcccctgaggaggat
gctggcctgcagtgcgtggtccagctgctccgccagcacagcagcccctggcaggtgtac
acgttcgtacgggcgtgtcttcaccggctggtgccccctggtctctggggctccagtcac
aataagtgccgcttcctcaggaacgtgaagatgttcatctctttggggaagcacgccaag
ctctccctgcaggagctgatgtggaagatgaaagtgcaggactgtgagtggctgcggcgg
agcccaggggattatgctgtcccggcctcggagcaccgtctgagagaagagatcttggcc
aagttcctcttctggctgatggacacgttcgtggttgggctgctcagggccttcttctac
gtcaccgagaccatgtttcagaagaacaggcttttctttttccggaaaagcgtctggaac
aagctgcagagcattggaatcagacaacacttcaacaaagtgcggctgcgagagttatct
gaagcggaggtccagcgacgccagcagaccaagccctctcttctgacctccaagctccgc
tttgtccccaaagcacatggccttcggccgattgtgaacatggactatgtcgtaggagcc
agaactttccgcagagaaaagaagcggctccagcatttcaactcgcagatgaaaaacctg
ttcagtgtgctcaactatgagcgggccgtgcggcctggcctgctgggggcctctgtgctg
ggcattgatgacgtgtacaaggcctggcgggcattcgtgcagcaggtgcgggccggagac
cctaggccgcagctgtactttgtcaaggtggatgtgacaggggcttacgacgccattcct
cacaacaagctggtggaagtgattgccaacgtgattaagcccaaagagaacatatactgc
atcagacgttatgctgtggtccagaaaactgcccagggatacattcggaaatccttcaaa
agacacgtctccaccttagcagacctcctgccttacatgaaacagttcgtggagcatttg
caggagacaagttccctgaagaatgccgttgtcatcgagcagagctcctccttaaatgag
cccgccagcagccttttcgatttcttcctgcacttggtgcacaacaatgtcataaagatc
cggggcaagtactacgtccagtgccaggggatcccgcagggctccatcctgtccaccctg
ctttgtagcttctgctatggagacatggagaacaagctgttttctggaatccaggaggat
gggttgctcttgcgtttggttgatgactttttgttggtgacacctcacctaacacaagct
aaagcctttctcagcaccctggtgagaggcgtccctgagtacggctgcatgatcaacttg
cggaagacggtggtgaatttccccgtggacgatggcccagggcaggccaccatcctccag
ctgccagcccactgcttgttcccctggtgcggcctgctgctcgacacccggaccctggag
gtgttctgtgactactccagttatgcacggacctcaatcaaagcgagtcttgtcttcaat
cacggcttcaaggctggaagaaacatgcgtcgcaagctctttgcagtcttgcgtctgaag
tgtcatggtctgtttttggatttgcaggtaaacagtcttcagacagtttacatcaacgtt
tacaagatctttctcctgcaggcctacaggttccatgcgtgcgtgctccagcttccattc
aatcagcaagttggaaagaatccctcgtttttcctcagagtcatctccgacacagcctta
cgctgctactccattctaaaagccaagaatgcaggtacgcgcggggtccagtggctgcgg
gggactgagccccaggcaccgtgtgggttccgaggatcgcccacggaactggtgagatgg
gaattgcccctgcacaaggccatctcacactgtttgccagcacattcctcagcggaatgc
ctgtgggcccgtggacgccactgttggtgtgagcagcatccaccttcttggcgttag

DBGET integrated database retrieval system