KEGG   Loxodonta africana (African savanna elephant): 100676455
Entry
100676455         CDS       T04351                                 

Gene name
KCNJ6
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 2
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04915  Estrogen signaling pathway
lav04921  Oxytocin signaling pathway
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100676455 (KCNJ6)
   04915 Estrogen signaling pathway
    100676455 (KCNJ6)
   04921 Oxytocin signaling pathway
    100676455 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    100676455 (KCNJ6)
   04725 Cholinergic synapse
    100676455 (KCNJ6)
   04728 Dopaminergic synapse
    100676455 (KCNJ6)
   04726 Serotonergic synapse
    100676455 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    100676455 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100676455 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100676455 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100676455 (KCNJ6)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100676455 (KCNJ6)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 100676455
NCBI-ProteinID: XP_010596950
UniProt: G3SZM5
LinkDB
Position
Unknown
AA seq 423 aa
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNPEEQTERNGDVANLENE
SKV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccaagctgacagagtccatgactaacgtcctggagggggactccatggatcaggac
gtggagagtcctgtggccattcaccagccaaagttgcctaagcaagctcgagatgacctg
ccaagacacatcagcagagatcggaccaaaaggaaaattcagaggtacgtgaggaaggat
gggaagtgcaacgtccaccacggcaatgtgagggagacctatcgttatctaacggatatc
ttcaccaccttggtggaccttaagtggcgattcaacctgttgattttcgtcatggtttac
acagtgacttggctcttctttggaatgatctggtggctaattgcttatatccgaggagat
atggaccacatagaggacccctcatggactccctgtgtcaccaacctcaacgggtttgtc
tctgcttttttattttcaatagagacagaaaccaccatcgggtatggctaccgggtcatc
acggacaagtgcccagagggaattattctcctcttaatccagtctgtgttgggctccatt
gtcaatgcattcatggtgggatgtatgtttgtaaaaatatctcaacccaagaagagggca
gagaccctggtcttttctacccatgcagtgatctctatgcgggatgggaaactgtgcctg
atgttccgggtgggggatctgaggaattcccacatcgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcggaaggggagttcatccccttgaaccagacagatatc
aacgtaggctattacacaggagatgaccgtctgttcctggtgtcaccgctgatcattagc
catgaaattaaccaacagagtcctttctgggagatctccaaagcccagctacccaaagag
gaactggaaattgtggtcatcctagaaggaatggtggaagccacagggatgacatgccaa
gcccgaagctcctacatcaccagtgagatcctgtggggttaccgcttcacacctgtcctg
accctggaggatgggttctatgaagtcgactacaacagcttccatgagacctatgagacc
agcaccccatccctcagtgccaaagagctggccgagttggccagcagggcagagctgccc
ctgagttggtctgtatccagcaaactaaatcaacatgcagaactggagaccgaggaggaa
gaaaagaaccctgaagagcaaacggaaaggaatggtgatgtggcaaacctagagaatgaa
tccaaagtttag

DBGET integrated database retrieval system