KEGG   Loxodonta africana (African savanna elephant): 100676492
Entry
100676492         CDS       T04351                                 

Gene name
NPR2
Definition
(RefSeq) atrial natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100676492 (NPR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100676492 (NPR2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100676492 (NPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100676492 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100676492 (NPR2)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100676492 (NPR2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100676492 (NPR2)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA
Other DBs
NCBI-GeneID: 100676492
NCBI-ProteinID: XP_003407337
UniProt: G3TEA4
LinkDB
Position
Unknown
AA seq 1047 aa
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQAIHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRSTGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQHRLLMRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGVPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIITEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADIYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPFFRPSIDRTQLNEELILLMERCWAQDPAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGERKGPAGLL
NT seq 3144 nt   +upstreamnt  +downstreamnt
atggcactgccatcactcctgctgttggtagcagccctggcaggtggggtgcgtcctccc
ggggctcggaatctgacgctggcagtggtgctgccagaacacaacctgagctatgcctgg
gcctggccgcgagtgggtcccgctgtggcactagctgtggaggcactgggccgagcactg
cccgtggacctgcggtttgtcagctctgaactagatggcgcctgttctgagtacctggca
ccactgcgtgctgtggacctcaagctgtaccatgaccctgaccttctgttgggccctggt
tgcgtgtacccagctgcctctgtagcccgctttgcctcccactggcgccttcccctgctg
actgcgggtgctgtggcctctggctttgcagctaagaacgagcattatcgtaccctggtt
cgcacgggcccctctgcgcccaagttgggtgagtttgtagtgacattgcatgggcacttc
aattggactgcccgtgctgccttgctatatctggatgctcgcacagatgaccgacctcac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
caggtgtatgcccgtgagccagggggccctgagcaggccatccacttcatccgggccaac
gggcgcattgtgtatatctgcggccctctggaaatgctgcatgagatcctgcttcaggcc
cagagggagaacctgaccaatggggattatgtcttcttttacctggatgtctttggggag
agtctccgtgcgggccccacgcgctctacaggccggccctggcaggacaaccgcacccgg
gaacaggcccaggctctcagagaggccttccagacggtattggtgatcacataccgagaa
cccccaaatcctgagtatcaagaattccagcatcgcctactaatgagagcccgggaagat
tttggtgtggagttggccccctccctgatgaaccttattgctggctgcttctacgatggg
atcctgctatatgctgaagttctgaatgagacaatacaggaaggaggcacccgggaagat
ggacttcgaattgtggagaagatgcagggacgaagataccacggtgtaactggactggtt
gttatggacaagaacaatgaccgggagactgattttgtcctgtgggccatgggagacctg
gattctggggactttcagcctgcagcccactactcaggagctgagaagcagatttggtgg
acaggacgacctattccatgggtgaagggggtcccccctttggacaaccctccctgtgcc
tttgacttggacgacccatcctgtgataaaactccactttcaactctggcaatagtggct
ctgggcacaggaatcaccttcatcatgttcggggtgtccagcttcctcattttccgaaaa
ctgatgctggagaaggagctggctagcatgttgtggcgcattcgctgggaagaactgcag
tttggcaattcagagcgttatcataaaggtgcaggcagtcgcctcacactgtcgctgcgg
ggatccagttacggctcgctcatgacagcccatgggaaataccagatctttgccaacacc
ggtcacttcaagggaaatgtcgttgccatcaaacatgtgaataagaagcgtattgagctg
acccggcaggttctgtttgaactcaaacatatgagagatgttcaatttaaccatctcact
cgcttcattggtgcctgcatagacccccccaacatttgcatcatcactgagtattgtcct
cgtgggagcttgcaggatattctggaaaatgacagcatcaacttggactggatgttccgt
tattcacttattaatgaccttgttaagggcatggcctttctccacaacagcattattgca
tcccatgggagtctcaagtcctccaactgtgtggtggatagtcgctttgtgctcaaaatc
acagactatggcctggccagcttccgatcaactgctgagcctgatgacagccacgccctc
tatgccaagaagctatggactgccccagaactgctcagtgggaaccccttgccaaccaca
ggcatgcagaaggctgatatctatagctttgggatcatcctacaggagatagcacttcgc
agtggtcctttctacttggagggcctggatctcagccccaaagagattgtccagaaggtc
cgaaatggtcagcggccatttttccgaccaagcattgaccggacccagctgaatgaagag
ctaattttgctgatggagcgatgttgggcccaggacccagctgagcggccagattttgga
cagattaaaggcttcattcgccgatttaacaaggagggtggcaccagcatattggacaac
ctcctgctgcgcatggagcagtatgccaataacctggagaagctggtagaggaacgcaca
caggcctacctggaggagaaacgcaaggctgaggctctgctctaccaaattctaccccat
tcagtggcagagcagttaaaacggggagagactgtacaggctgaggcctttgacagtgtc
accatctacttcagtgacatcgtcggcttcacggccttgtcagcagaaagcacccccatg
caggtggtgacacttcttaatgacctgtatacctgctttgatgccataattgacaacttt
gacgtctacaaggtggagacaattggagatgcttacatggtggtatctggccttccaggc
cgaaatggtcaacgtcatgctccggaaattgctcgtatggccctagcattactggatgcg
gtttcttccttccgcatccgccaccggccccacgaccaactgagactacgcataggggtc
catactggtccagtctgtgctggggttgttggcctgaagatgccccgctattgtcttttt
ggagacacggtgaacactgcttcgcgaatggagtccaatggtcaagccctgaagatccat
gtctcctctaccaccaaggatgctctggatgagctaggatgcttccagctagagcttcgg
ggggatgtggagatgaagggaaagggaaagatgcgaacttactggctcctaggagagcgg
aaaggacctgctggactcctgtaa

DBGET integrated database retrieval system