KEGG   Loxodonta africana (African savanna elephant): 100676506
Entry
100676506         CDS       T04351                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1 isoform X1
  KO
K04265  adenosine receptor A1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04071  Sphingolipid signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100676506 (ADORA1)
   04024 cAMP signaling pathway
    100676506 (ADORA1)
   04022 cGMP-PKG signaling pathway
    100676506 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676506 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100676506 (ADORA1)
   04924 Renin secretion
    100676506 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100676506 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100676506 (ADORA1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    100676506 (ADORA1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100676506
NCBI-ProteinID: XP_010588525
UniProt: G3SN99
LinkDB
Position
Unknown
AA seq 326 aa
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMFACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSQVRQDWVANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHVLNCITLFCPSCHKPSILIYVAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPAPPIEEDLPEERPGD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgccgccctccatctcggccttccaggccgcttacatcggcatcgaggtgctcatcgcc
ctggtttccgtgcccgggaatgtgctggtgatctgggcggtgaaggtgaaccaggcacta
cgggatgccaccttctgcttcatcgtgtcgctggcggtggctgatgtggcagtgggcgct
ctggtcatcccgctcgccatcctcatcaacatagggccacagacctacttccatacctgc
ctcatgttcgcctgtcctgtcctcatcctcacccagagctccatcctggccctgctggcg
atcgctgtggaccgctatctccgtgtcaagatcccgctccggtacaagacggtggtgacc
ccccggagggccgcagtggccattgccggctgctggatcctctcctttgtggtgggcctg
acccctatgtttggctggaacaacctgagccaggtgagacaggactgggtggcaaacggc
agtgtgggcgagcctgtgatcaagtgtgagtttgagaaggtcatcagcatggagtacatg
gtctacttcaacttcttcgtctgggtgctgcccccgctgctcctcatggtcctcatctac
ctggaggtcttctacctgatccgcaagcagctcaacaagaaggtgtcggcctcctccggc
gacccgcagaagtactatgggaaggagttgaagatcgccaagtcgctggccctcatcctc
ttcctcttcgccctcagctggctgcccctgcatgtcctgaactgcatcaccctcttctgc
ccctcctgccacaagcccagcatcctcatctacgtcgccatcttcctcacgcatggcaac
tcagccatgaaccccatagtctatgccttccgcatccacaagttccgggtaaccttcctt
aagatctggaacgaccatttccgctgccagcctgcaccccccattgaggaggaccttccg
gaagagaggccaggtgactag

DBGET integrated database retrieval system