KEGG   Loxodonta africana (African savanna elephant): 100676629
Entry
100676629         CDS       T04351                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100676629 (SFN)
   04115 p53 signaling pathway
    100676629 (SFN)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100676629 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676629 (SFN)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100676629 (SFN)
  Exosomal proteins of colorectal cancer cells
   100676629 (SFN)
  Exosomal proteins of bladder cancer cells
   100676629 (SFN)
SSDB
Motif
Pfam: 14-3-3 SIKE
Other DBs
NCBI-GeneID: 100676629
NCBI-ProteinID: XP_023410169
LinkDB
Position
Unknown
AA seq 248 aa
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYRDKVETELRGVCDTVLGLLDSHLIKEAGDAEGRVFY
LKMKGDYYRYLAEVATGDDKKRIINAARAAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANVPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGG
EAPEEPQS
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagagagccagcctgatccagaaggccaagttggcagagcaggccgagcgctatgag
gacatggcagccttcatgaagggagccgtggagaagggtgaggaactatcctgcgaagag
cgcaacctgctctcagtggcctacaagaacgtggtgggcggccagagggctgcctggagg
gtcctgtccagcatcgagcaaaaaagcaacgaggagggctcagaagaaaagggccctgag
gtgcgagagtaccgggacaaggtggagactgagctccggggtgtatgcgacactgtgctg
ggcctgctggactcccacctcatcaaggaggctggtgatgctgagggccgggtcttctac
ctgaagatgaaaggtgactactaccgctacctggccgaggtggccacaggtgacgacaag
aagcgcattatcaacgcagctcgggcagcctaccaagaggccatggacatcagcaagaag
gagatgccacccaccaaccccatccgcctgggcctggcactgaacttttctgtcttccac
tatgagattgccaacgtccctgaggaggccatctcgctggccaagaccacctttgatgag
gccatggctgacctgcacactctcagcgaggactcctacaaagacagcaccctcatcatg
cagctgctgcgagacaatctgacgctgtggacggccgacagtgctggggaagaggggggc
gaggctccggaggagccccagagctga

DBGET integrated database retrieval system