KEGG   Loxodonta africana (African savanna elephant): 100676634
Entry
100676634         CDS       T04351                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00330  Arginine and proline metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04146  Peroxisome
lav04371  Apelin signaling pathway
lav04926  Relaxin signaling pathway
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05133  Pertussis
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100676634 (NOS2)
   00330 Arginine and proline metabolism
    100676634 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100676634 (NOS2)
   04066 HIF-1 signaling pathway
    100676634 (NOS2)
   04020 Calcium signaling pathway
    100676634 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100676634 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100676634 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100676634 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100676634 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100676634 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100676634 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100676634 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100676634 (NOS2)
   05152 Tuberculosis
    100676634 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100676634 (NOS2)
   05145 Toxoplasmosis
    100676634 (NOS2)
   05140 Leishmaniasis
    100676634 (NOS2)
   05142 Chagas disease
    100676634 (NOS2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100676634 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100676634
NCBI-ProteinID: XP_023411890
LinkDB
Position
Unknown
AA seq 1071 aa
MTFDDTLHQKAKGDLACKSKSCLGSLMSPKSFTKGPRDKPTPPDELLPQAIEFVNQYYSS
FKEAKIEEHLARLEVVANEIGTTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQVFD
ARSCTTAKEMFEHICRHIRYSTNQGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMP
DGNIIGDPASMEFTQLCIDLGWKPKYSRFDVLPLVLQANGRDPELFEIPPDLVLEVPLEH
PKYEWFRELELKWYALPAVANMLLEVGGLDFPGCPFNGWYMGTEIGVRDLCDVQRYNILE
EVGRRMGLETHKVASLWKDRAVVEINIAVLHSFQKQNVTIMDHHSASESFMKYMQNEYRS
RGGCPADWVWLVPPISGSITPVFHQEMLNYILSPFYYYQVEAWKTHTWQDEKRRPRGREI
QFKVLAKAVLFASVLMRKVMASRVRVTILFATETGKSETLAQDLGALFHCAFNPKVFCMD
EYRLSDLEKERLLLVVTSTFGNGDSPGNGEKLKKSLFMLKELTNKFRYAVFGLGSSTYPR
FCAFAHDIDQKLSQLGASQLTLTGEGDELSGQEEAFRSWAVQTFKAACEIFDIRGKHHIQ
IPKLYTSSETWDPHQYRLVQDSEPLDLNKALGSMHGKNVFTMKLKSQRNLQSLKSSRATL
LVELSYEGSQGLNYLPGEHLGVFPGNQPALVQGILERLVDGPAPHQSVRLEVLSENGSYW
VRDKRLPPCSLSQALTYFLDITTPPTQLLLRKLTQLATEDAERRRLEALCQPSEYNKWKF
TNSPTFLEVLEEFPSLRISAGFLLSQLPTLKPRYYSISSSQDHTPAEVHLTVAVVTYRTR
DGQGPLHHGVCSTWLSNLKPQDPVPCFVRSASGFQLPEDPSQPCILIGPGTGIAPFRSFW
QQRLHDIEHKGLLRGPMTLVFGCRRPDEDHIYREEMLEMARKGALHEVHTAYSRLPGQPK
VYVQDILRHQLAGEVLRVLHKEQGHLYVCGDVRMARDVEQTLKQLVATKLSLSEEQVEDY
FFQLKTQKRYHEDMFGAFICYEVKTGTAVDQIGESRALTIHGTSRRHWHGI
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgacttttgacgacacgcttcaccaaaaggccaaaggggatcttgcttgcaagtccaag
tcttgcctggggtctctcatgagccccaaaagttttaccaaaggaccaagggacaagcct
acccccccggatgagcttctacctcaagctatcgaatttgtcaaccagtattacagctcc
ttcaaagaggcaaaaatagaggaacatctggccaggttggaagtggtagcaaatgagatc
ggaacaacaggaacctaccagctgacaggggatgagctcatctttgccaccaagcaggcc
tggcgcaatgccccccgctgcatcggaaggatccagtggtctaacctacaggtctttgac
gcccggagctgtaccaccgcaaaggaaatgtttgaacacatctgcagacatatacgctat
tccaccaaccagggcaacataaggtcggccatcacggtgttcccccagcggagtgacggg
aagcatgacttccgggtgtggaacgctcagctcatccgttatgctggctaccagatgccc
gatggcaacatcataggagaccccgccagcatggagttcacccagctatgcattgaccta
ggctggaagcccaagtacagccgcttcgacgtgttgcctctggtcctgcaggcgaatggc
cgtgaccctgagctctttgaaattccacctgaccttgtgcttgaggtgcccctagagcat
cctaagtacgagtggtttcgggagctggagctgaagtggtacgccctgcctgcagtggcc
aacatgctgcttgaggtgggcggcctcgactttccagggtgccccttcaatggctggtac
atgggcacggagatcggagtccgggacctctgtgacgttcagcgctacaacatcctggag
gaagtgggcaggaggatgggcctggaaacacacaaggtggcctccctttggaaagaccgg
gctgtcgttgagatcaacattgccgtgctccacagtttccagaagcaaaatgtgaccatc
atggaccaccactcagcttcagagtccttcatgaagtacatgcagaatgagtaccggtcc
cgtgggggctgcccagctgattgggtttggctggtcccgccaatttctgggagcatcacc
cccgtgtttcatcaggagatgttaaactatatcctgtcccctttctactattatcaggtg
gaggcctggaaaacccacacctggcaggatgagaagcggaggcccaggggaagagagatt
caattcaaagtcttggctaaagccgtgctcttcgcctctgtgctgatgcgcaaagtcatg
gcatcacgagtcagagtcacaatcctctttgcaacagagacgggaaaatcagaaacattg
gcccaggacctgggggccttgttccactgcgccttcaaccccaaggttttctgcatggat
gagtacaggctgagtgacctggagaaggagcggctgctactggtggtgaccagcacgttt
gggaatggagactctcccggcaacggagagaaactgaagaaatcgctcttcatgttgaaa
gagctcactaacaaattcaggtatgccgtgtttggccttggatccagcacataccctcgg
ttctgcgcctttgcacatgacattgaccagaagctctcccaactgggggcctctcagctc
accctgacaggggaaggagatgagctcagtgggcaggaggaagccttccgcagctgggct
gtgcaaacattcaaggcagcatgtgagatatttgatatccgaggcaaacaccatattcag
atccccaagctgtacacctccagtgagacctgggacccacaccagtacaggctcgtgcaa
gactcagagcctttggacctcaacaaagcccttggcagcatgcatggcaagaatgtgttc
actatgaagctcaaatcccaacggaacctgcagagtctgaaatccagccgagctaccctc
ttggtggaactgtcctatgagggcagccaaggcctgaactacctgcctggagagcacctc
ggggttttcccaggcaaccagccggccctggttcaaggcatcttggaacgcctggtggat
ggacctgcaccccaccaatcggtgcgcctggaagtcctcagtgagaacggcagctactgg
gtcagggataagagactgcccccctgctcactcagccaggccctcacctacttcctggac
atcaccacacccccaacccagctactgctccgaaaactgacccaactggccacggaagat
gctgagagacggaggctggaggccctgtgtcagccctcagagtacaacaagtggaagttc
accaacagccctacattcctggaagtgcttgaggagttcccgtccctgcgaatatctgct
ggcttcctactctcccagctccccactctgaaaccccggtactactccatcagctcctcc
caggaccacacgcccgcagaagtccacctgactgtggccgtggtcacataccgcacccga
gatggccaaggtcccctgcaccacggcgtctgcagcacttggctcagcaacctgaagccc
caagatccagtgccctgttttgtgcgcagtgccagcggcttccagctccctgaggacccc
tcccagccttgcatcctcattgggcctggtacgggcattgcccccttccgcagtttctgg
cagcagcggctccatgacatcgagcacaaagggctcctgagaggccccatgacgctggtg
tttggctgccgccgccctgatgaggaccacatctaccgggaggagatgctggagatggcc
cggaagggagcgctgcatgaggtgcacacagcctattctcgcctgcctggccagcccaag
gtctatgttcaagacatcctgcgacaccagctggctggcgaggtgctccgtgtgctccac
aaagagcagggccatctctatgtctgcggggatgtgcgtatggcccgggacgtggaacaa
accctgaaacagctggtggctaccaagctgagcctgagtgaggagcaggttgaggactat
ttcttccaactcaagacccagaagcgctatcatgaagatatgttcggtgctttcatatgc
tatgaggtgaaaacgggcacagcagtggaccaaatcggtgaatccagagctctgacgata
catggaacaagtcgaaggcactggcatggaatttag

DBGET integrated database retrieval system