KEGG   Loxodonta africana (African savanna elephant): 100676641
Entry
100676641         CDS       T04351                                 

Gene name
GRM5
Definition
(RefSeq) LOW QUALITY PROTEIN: metabotropic glutamate receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100676641 (GRM5)
   04072 Phospholipase D signaling pathway
    100676641 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676641 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100676641 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100676641 (GRM5)
   04720 Long-term potentiation
    100676641 (GRM5)
   04723 Retrograde endocannabinoid signaling
    100676641 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100676641 (GRM5)
   05016 Huntington disease
    100676641 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    100676641 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100676641 (GRM5)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100676641 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G GluR_Homer-bdg Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 100676641
NCBI-ProteinID: XP_010596521
LinkDB
Position
Unknown
AA seq 1217 aa
MCLNSFPKMVLLLILAVLFLKEDVRGSAQSNERRVVAHMPGDIIIGALFSVHHQPTVDKV
HERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEF
IRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAY
SATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFK
DMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRR
LGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRN
PWFQEFWQHRFQCRLEGFAQENNKYNKTCDSSLTLRTHHVQDSKMGFVINAIYSMAYGLH
NMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK
EMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNMIRSVCSEPCEKGQIKVIRKGEVSCCW
TCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLL
ATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIG
LSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIIALF
IMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAK
YIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERN
VRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIEC
FTPKGSMGNGGRATMSSSNGKSVTWAQNERSTRGQHLWQRLSIHINKKENPNQTAVIKPF
PKSTEIRGLGVSSSGAAPGAGGAGGSGAGPSGPEPPEASPKALYDVAEAEEHFPAPARPR
SPSPISTLSHRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNS
MMLSTTAPGRGVGTPLCSTYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAVGAPPAG
GAPETPVARPEAAAAGKPDLEEVGGSHPAHPPFRDSVGLGEYNPNSARCSESALCIAFGP
NYDTLIIRHYTQSSSSL
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtgcttgaactcctttcctaaaatggtccttctgttgatcctggcagtcctatttttg
aaagaagatgtccgtgggagtgcacagtccaatgagaggagggtggtggctcacatgccc
ggtgacatcattattggagctctcttttctgtccatcaccagccaacggtggacaaagtt
catgagaggaagtgcggggcagttcgtgaacagtatggcattcagagagtggaagccatg
ctgcacaccctggaaaggatcaactcagatcccactctcttgcccaacatcacactgggc
tgtgagataagggattcctgctggcattcggctgtggctctagagcagagtattgagttc
ataagggactccctcatttcttcagaagaggaagagggcttggtgcgctgcgtagatggc
tcttcctcttctttccgctccaagaagcccatagtgggggtcattgggcctggctccagt
tctgtggccattcaggtccagaacttgctccagcttttcaacatacctcagattgcttat
tcggcaacaagcatggatctgagcgacaagactctgttcaagtatttcatgagagttgtg
ccttcagatgcccagcaggcacgggctatggtggacatagtgaagaggtataactggacg
tatgtgtcagctgtacacacagaaggcaactatggagaaagtgggatggaggctttcaaa
gacatgtcagccaaggaagggatttgcatcgcccactcttacaaaatctacagcaatgcg
ggggagcagagctttgacaagctgttgaagaagctcagaagccacttgcccaaggcccgg
gtggtagcctgcttctgtgaggggatgacggtgagaggtctgctcatggctatgaggcgc
ctaggcctagcaggagaatttctgctcctgggcagtgatggctgggctgacaggtacgac
gtgacagatggatatcaacgagaagctgtgggtggaatcacaatcaagctccagtcacca
gatgtcaagtggtttgatgattattatctgaagctccggccagaaacaaacctccgaaat
ccttggtttcaagaattttggcagcatcgttttcagtgccggctggaagggtttgcacag
gagaacaacaaatacaacaagacttgcgatagttctctgaccctgagaacacatcatgtt
caagattccaaaatgggatttgtgatcaacgcaatctactccatggcctatggtcttcac
aacatgcagatgtccctctgcccaggctatgcaggcctctgtgacgcaatgaaaccaatt
gatgggagaaaacttttggactccctgatgaaaaccaattttactggtgtttctggagat
atgatcctatttgatgagaatggagactccccaggaaggtacgaaatcatgaatttcaag
gaaatgggaaaagattattttgattacatcaatgttggaagctgggacaatggagaatta
aaaatggatgatgatgaggtatggtccaagaaaagcaacatgatcagatctgtgtgcagc
gagccatgtgagaaaggccagataaaggtgatccggaagggagaggtgagctgttgctgg
acctgtacaccttgtaaagagaatgagtatgtctttgatgagtacacctgcaaggcgtgc
cagttaggatcctggcccactgatgaccttacaggttgtgatttgattcctgtacagtat
cttcgctggggtgaccctgagcccattgcagctgtggtgtttgcctgccttggcctgctg
gctaccctgtttgttactgtagtcttcatcatttaccgtgatacaccagtagtcaagtcc
tccagcagagaactctgctacattatccttgcaggcatctgcctgggctacctatgtacc
ttctgcctcattgcaaagcctaaacaaatttattgctaccttcagagaattggcattggt
ctctccccagccatgagctactcagcccttgtaaccaagaccaaccgtattgcaaggatc
ctggccggcagcaagaagaagatctgtaccaaaaagcccagattcatgagtgcctgtgcc
cagctggtgattgctttcattctcatatgcatccagttgggcatcatcatcgctctcttt
ataatggagcctccagacataatgcatgactacccaagcatccgggaagtctacctgatt
tgtaacaccaccaacctaggagttgtcactcctcttggatacaacggactgttgatttta
agctgcaccttctatgcgttcaagaccagaaatgttccagctaacttcaatgaggccaag
tacattgccttcacaatgtacaccacctgcattatatggctggcctttgtgccaatctac
tttggcagcaactacaaaatcatcaccatgtgtttttcagtcagtctaagtgccacagtg
gctctaggctgcatgtttgtgccgaaggtctacatcatcctggcgaaaccagagagaaat
gtgcgcagcgccttcaccacatccactgtggtgcgtatgcatgtgggggatggcaagtca
tcctcagcggccagcagatccagcagcctagtcaacctctggaagaggaggggatcctct
ggggaaaccctaaggtacaaagacaggagactggcccagcacaagtcggaaatagaatgt
ttcacccccaaagggagtatggggaatggtgggagagcaacaatgagcagctccaatgga
aaatctgtcacatgggcccagaatgagagaagcacccggggacagcacctgtggcagcgg
ctgtccattcacatcaacaagaaagagaaccccaatcaaacggctgtcatcaagcccttc
cccaagagcacggagatccgcggcctgggcgtgagcagctcgggcgcagccccaggcgca
ggcggtgcgggcggctcgggcgccggccctagcgggcctgagcccccagaagccagcccc
aaggcgctgtatgatgtggcggaggccgaggagcacttcccggcgcccgcacggccgcgc
tcgccgtcgcccatcagcacgctgagccaccgcgctggctcggccagccgcacagacgac
gacgtgccctcactgcactcggagcccgcggcgcgcagcagctcctcgcagggctcgctc
atggagcagatcagcagcgtggtgacccgcttcacggccaacatcagcgagctcaactcc
atgatgctgtccaccacagctcctgggcgcggcgtgggcactccactctgctccacctac
ctgatccccaaagagatccagctgcccacgactatgaccacgttcgctgaaatccagcct
ctgccagccatcgaggtcacgggcggtgcgcagcctgcggtgggggccccgccggccggg
ggcgctccggagacccctgtggcccggcccgaagctgctgcagctggcaagccggacttg
gaagaagttggtggctctcaccccgcccatccccctttcagagactcggtgggactcggg
gagtacaaccccaactccgcccggtgttccgagtcggccctctgtatcgcattcggccca
aattatgacacacttatcataagacattacactcagagctcctcatccttgtga

DBGET integrated database retrieval system