KEGG   Loxodonta africana (African savanna elephant): 100676652Help
Entry
100676652         CDS       T04351                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2 isoform X1
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04062  Chemokine signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04630  Jak-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04725  Cholinergic synapse
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05200  Pathways in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100676652 (JAK2)
   04151 PI3K-Akt signaling pathway
    100676652 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100676652 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100676652 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100676652 (JAK2)
   04659 Th17 cell differentiation
    100676652 (JAK2)
   04062 Chemokine signaling pathway
    100676652 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100676652 (JAK2)
   04917 Prolactin signaling pathway
    100676652 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    100676652 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100676652 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100676652 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100676652 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100676652 (JAK2)
  09172 Infectious disease: viral
   05164 Influenza A
    100676652 (JAK2)
   05161 Hepatitis B
    100676652 (JAK2)
   05168 Herpes simplex virus 1 infection
    100676652 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100676652 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100676652 (JAK2)
   05140 Leishmaniasis
    100676652 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100676652 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100676652 (JAK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100676652 (JAK2)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100676652 (JAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 100676652
NCBI-ProteinID: XP_010598294
LinkDB All DBs
Position
Unknown
AA seq 1130 aa AA seqDB search
MACLTVTDMEGTSTSPVHQNGDIPGPANTVKQVEPVLQVYLYHSLGKAEEDYLRFPAGEY
VAEDICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHVDESASHSVLYRIRFYFPH
WYCNGSNRTYRYGIARGAEAPLLDDFVMSYLFAQWRHDFVCGWIKLPVTHETQEECLGLA
VLDMMRIAKEKGQTPLAIYNSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQ
CKATARNLKLKYLINLEALQAAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSRGK
HKESETLTEQDLQIYCDFPDIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLREA
LSFVSVIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQTGL
YVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLTGTKKNFNNLKDLLNCYQ
METVRSDSIIFQFIKCCPPKPKDKSNLLVFRTNGVSDVPTSPALQRHNNVNQMVFHKIRN
EDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRSYSESFFEAASMMS
QLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMH
FLEEKALIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWAPPE
CIENPKNLSLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELAN
LINNCMDYGPDFRPSFRAIIRDLNSLFTPDYELLTESDMLPNMRIGALGFSGAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPEGCPDEIYVIMTECWNNHVNQRPSFRDLALRVDRIRDNMAG
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttacggtgacagacatggaaggaacgtccacatctcctgtacaccagaac
ggtgatattcctggccctgcgaacactgtgaagcaggtagagccagtcctgcaggtgtat
ctttaccattcccttgggaaggctgaagaagattacctgaggtttccagcgggggagtat
gttgctgaagacatttgtgttgctgcttctaaagcttgtggcatcacacctgtgtatcat
aacatgtttgctttaatgagtgaaacagaaaggatctggtatccgcccaaccacgtcttc
cacgtagatgaatcagccagccacagtgtactctacaggataaggttttactttcctcac
tggtattgtaacggcagcaacagaacctatcggtatggaatagctcgaggtgctgaagct
cctctcctggatgactttgtcatgtcttacctgtttgctcagtggcggcacgattttgtc
tgtggctggataaaattaccagtgactcatgaaacacaggaagaatgtcttgggctggcc
gtgttggatatgatgagaatagccaaggaaaagggtcaaaccccactggccatctataac
tccatcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagattatcat
attctgacaaggaaacgaataaggtacaggtttcgcagatttattcagcagttcagccaa
tgcaaagccactgccagaaacttgaaacttaagtaccttataaatctggaagcccttcag
gctgccttctacacagagcagtttgaagtaaaagaacctggaagaggtccttcaggtgag
gagatttttgcaaccattataataactggaaacggtggaattcagtggtcaagagggaaa
cataaagaaagtgagacactgacagaacaggatttacagatatattgtgattttcctgat
attattgatgtcagcattaagcaagcaaaccaagaaggctctaatgaaagcagagttgta
actatccataagcaagatggtaaaaatctggaaattgaacttagctccctaagagaagcc
ttgtcttttgtgtcagtgattgatgggtactacagactcactgccgacgcacaccattac
ctctgcaaagaagtggcccccccaacagtgctggaaaatatacagagcaactgtcatggg
ccaatttcaatggattttgccatcagtaaactgaagaaagctggtaatcagactgggctg
tatgtacttcgatgcagtcctaaggactttaataaatattttctcacgtttgctgttgag
cgagaaaatgtcattgaatataagcactgtttgattacaaaaaatgagaatggagaatac
aacctcactgggactaagaagaactttaataatcttaaagatcttctgaactgctatcag
atggaaactgttcgttcagacagtatcattttccagtttattaaatgctgccccccaaag
ccaaaagataaatccaacctcttagtcttcagaacgaacggcgtttctgatgtcccaacc
tcaccagcattacagaggcataataacgtgaaccagatggtgtttcacaaaatcagaaat
gaagatttgatattcaatgaaagtcttggccaaggcacttttacaaaaattttcaaaggt
ataagaagagaagtaggagactacggtcagctgcacgaaaccgaggttctcctcaaagtc
ctggataaagcacacagaagctactccgagtctttctttgaagcggcaagcatgatgagc
cagctttctcacaagcacctggttttaaactatggagtatgtgtctgtggagaggagaat
atcctggttcaagagtttgtaaaatttggatctctagatacatatctgaaaaaaaataaa
aattctataaatatattatggaaacttgaagtggctaaacagttggcatgggccatgcat
tttctcgaagaaaaagcccttattcatgggaacgtgtgtgccaaaaatatcctgctcatc
agagaagaagacaggaagacagggaatccgcctttcatcaaactcagtgaccctggcatt
agtattacggttttgccaaaagacattctccaggagagaataccatgggcacccccagaa
tgtattgaaaatcctaaaaacctaagcttggcaacagataaatggagttttgggactact
ctgtgggaaatctgcagtggaggagacaagcctctcagtgctctagattcccaaaggaag
ctacagttttatgaagacaggcaccagcttcctgcaccaaagtggacagagttagcaaat
cttataaacaattgtatggattacggaccggattttaggccttctttcagagccatcata
cgagatcttaacagcttgtttactccagattatgaactattgacagaaagtgacatgtta
ccaaatatgaggataggtgccctaggattttctggtgcttttgaagacagggaccctaca
cagtttgaagaaagacacttgaaattcttacaacaacttggcaagggtaattttgggagt
gtggagatgtgccggtatgaccctctgcaggacaacactggggaggtggtggccgtgaag
aagctccagcacagtactgaggagcacctccgggactttgaaagggaaattgagatcctt
aaatccctgcagcacgacaacatcgtgaagtacaagggagtgtgctacagtgctggccgg
cgtaatctgagattaattatggagtatttaccatatggaagtttacgagactatctccaa
aaacataaagaacggatagatcataaaaaacttctgcagtacacatctcagatatgcaag
ggtatggaatatcttggtacaaaaaggtacattcacagggatctggcaacaagaaatata
ttggtggagaatgagaacagagttaaaattggggattttggattgactaaagttttgcca
caagacaaagaatactacaaagtgaaagaaccgggtgaaagtcccatattctggtatgcc
ccagaatcactgacagagagcaagttttctgtggcctcggatgtttggagctttggagtg
gttctctatgagcttttcacatacattgagaagagtaaaagtccaccggcggaatttatg
cgtatgattggcaatgacaagcaaggacagatgattgtgttccatttgatagaactcttg
aagaataatggaagattaccaagaccagagggatgcccagatgagatttatgtgatcatg
acagaatgctggaacaatcatgtaaaccagcgcccttccttcagggacctagctcttcga
gtggatcgaataagggacaacatggctggatga

DBGET integrated database retrieval system