KEGG   Loxodonta africana (African savanna elephant): 100676691
Entry
100676691         CDS       T04351                                 

Gene name
AQP3
Definition
(RefSeq) aquaporin-3
  KO
K09876  aquaporin-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100676691 (AQP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100676691 (AQP3)
Transporters [BR:lav02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    100676691 (AQP3)
SSDB
Motif
Pfam: MIP aGPT-Pplase1
Other DBs
NCBI-GeneID: 100676691
NCBI-ProteinID: XP_023400964
LinkDB
Position
Unknown
AA seq 318 aa
MSPSSRGCGWSRRGLSWVLEKPSSSPDSRRQGLLASTFPSGVTTSGPQLGVTLPVLLYFL
PQMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLA
REPWIKLPVYTLAQTLGAFLGAGIIFGLYYDAILAFANNEFIVSGPNGTAGIFATYPSGH
LDMVNGFFDQFIGTASLIVCVLAIVDPNNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAV
NPARDFGPRLFTAIAGWGSEVFTTGKHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPA
STEQENVKLAHMKHKEQI
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtctccttcttctagggggtgtggctggagcaggaggggtttgagttgggtcctagaa
aagccctccagctctcctgatagtcgcaggcaggggttgctggcttcaacttttccctct
ggagtgacaacttctggtcctcagctgggcgtcaccctccctgtcttgctctatttcctg
ccacagatgtttggctgtggctctgtggcccaggtcgtgctcagccggggcacacatgga
ggcttcctcaccatcaacctggccttcggcttcgctgtcactctgggcatcctcattgct
ggccaggtttctggggcccacctgaaccctgctgtaacctttgccatgtgctttctggca
cgcgaaccctggatcaagctgcccgtctataccctggctcagacgctgggagccttcctg
ggtgctgggatcatttttggactgtattatgatgcaatcttggcctttgccaacaatgag
tttatagtctcgggccccaacggcacagctggcatctttgccacttacccctctggacac
ttggacatggtcaatggcttcttcgaccagttcattggcaccgcctccctcattgtctgt
gtgctggctattgttgacccaaacaacaacccagtcccccgtggcctggaggccttcacc
gtgggcctggtggtcctggtcatcggcacctccatgggcttcaactccggctatgctgtc
aaccctgcccgagactttggcccccgtcttttcaccgccatcgctggttggggctctgag
gtcttcacgactggcaagcactggtggtgggtgcccattgtctccccactcctgggctcc
atcgctggcgtcttcgtgtaccagctcatgattggctgccacctggagcagcccccagct
tctactgagcaggagaatgtgaagctggcccatatgaagcacaaggagcagatatga

DBGET integrated database retrieval system