KEGG   Loxodonta africana (African savanna elephant): 100676924
Entry
100676924         CDS       T04351                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00350  Tyrosine metabolism
lav01100  Metabolic pathways
lav04916  Melanogenesis
Module
lav_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100676924 (TYR)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100676924 (TYR)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100676924 (TYR)
SSDB
Motif
Pfam: Tyrosinase Laminin_EGF
Other DBs
NCBI-GeneID: 100676924
NCBI-ProteinID: XP_003418603
UniProt: G3TGJ7
LinkDB
Position
Unknown
AA seq 530 aa
MRLVVLYCLLWSFHTSAGHFPRACVSSKSMMEKECCPPWSGDGSPCGQLSGRGSCQDVLL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFDCGNCRFGFWGPNCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSADYVIPTGTYGQMNNGSRPMFRDINIYDLFVWMH
YYVSRDTLLGGSEIWSDIDFAHEAPGFLPWHRLFLLQWEKEIQRLTGDENFTIPYWDWRD
AEDCDICTDEYMGGHHPANPNLLSPASFFSSWQIVCSRMEEYNSRQALCDGTPEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESGSMNKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRYHPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSRELGYDYSYLRDSEPDSFQDYIKSYLEQASQIWQWLLG
AAVVGAVLTAVLGRLASLLCRCRRKQLPEEKQPLLMEKDDYHSLLSQSHL
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcgcctggttgttttgtactgcctgctgtggagttttcatacttccgccggccatttc
cctcgagcctgtgtgtcttctaagagtatgatggagaaggaatgctgccctccgtggagt
ggggatgggagtccctgtggccagctttcaggcaggggttcctgtcaggacgtccttctg
tccaatgcaccactcgggcctcaattccccttcacaggggtggatgaccgggagtcttgg
ccttctgtcttttataacaggacctgccagtgctctggcaacttcatgggatttgactgt
ggaaattgtaggtttggcttttgggggccaaactgcacagagaggcgactgttagtaaga
agaaacatctttgatttgagtgtcccagagaagaacaaattccttgcctacctcacttta
gcaaaacataccaccagtgcagactatgttatccccacaggcacctatggccaaatgaac
aatggatcaagacccatgtttagagacatcaacatctatgacctctttgtctggatgcat
tattatgtgtccagagacacactgctcgggggatctgaaatctggagcgacattgatttt
gctcatgaagcaccaggcttcctgccttggcatagactcttcttgctgcagtgggaaaaa
gaaatccagaggctgacaggggatgagaacttcactattccgtactgggactggcgggat
gcagaagactgtgacatttgcacagacgagtacatgggagggcaccacccagcaaaccct
aacctactcagcccagcatccttcttctcttcttggcagatcgtctgcagccgaatggag
gagtacaatagccgtcaggctttatgcgatggaacacctgagggacccttactgcgcaat
cctggaaaccatgacaaagccaggaccccgaggctgccctcctcagctgatgtggaattt
tgcctgagtttgacccagtatgaatctggctccatgaataaagctgccaatttcagcttt
agaaatacactagaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agtatgcacaatgctttgcacatctatatgaatggaacgatgtcccaggtgcaaggatct
gccaatgaccccatctttcttcttcatcatgcatttgttgacagtatttttgaacagtgg
ctccgaagataccatcctcttcaagaagtttatccagaagctaatgcacccattggacat
aaccgggaatcctacatggttccttttatacctctctacagaaatggtgatttctttatt
tcatccagagagctcggctatgactatagctacctacgggattcagaaccagactccttt
caagactacattaagtcctacttggaacaagccagtcagatctggcaatggctccttggg
gcggctgtggtaggggctgtcctcactgctgtgctggggagactcgccagcctgctgtgt
cgttgcaggagaaagcagctccctgaagaaaagcagcccctcctcatggaaaaagatgat
tatcacagcttgttgtcacagagccatttataa

DBGET integrated database retrieval system