KEGG   Loxodonta africana (African savanna elephant): 100676974
Entry
100676974         CDS       T04351                                 

Gene name
AQP7
Definition
(RefSeq) aquaporin-7
  KO
K08771  aquaporin-7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100676974 (AQP7)
   03320 PPAR signaling pathway
    100676974 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100676974 (AQP7)
Transporters [BR:lav02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    100676974 (AQP7)
SSDB
Motif
Pfam: MIP aGPT-Pplase1
Other DBs
NCBI-GeneID: 100676974
NCBI-ProteinID: XP_023401098
LinkDB
Position
Unknown
AA seq 217 aa
MVLGENKLGSYLGVNLGFGFGVTMGVHVSGGISGAHMNSAVTFASCALGRMSWKKFPVYV
LGQFLGSFLAAATIYGLFYTSINHFSGGHLTVTGPTATAGIFATYPPSHMTLWWGFLNEV
LLTGLLQLCLFAIMDKQNNPAMEGTQALVIGILVVIIGVSLGMNTGYAINPSRDLPPRFF
TFIAGWGSEVFRWHHLPALPWLQHPTGTKDSDGAQDV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggttctaggagagaataaacttgggagctacctcggtgtcaacttggggtttggcttc
ggagtcaccatgggagtgcacgtgtcagggggcatctctggggcccacatgaactcagct
gtgaccttcgccagttgtgctttaggccgcatgtcctggaagaagtttcctgtctacgta
ctgggtcagttcctgggctccttcctggccgctgccaccatatatggcctcttctacaca
tccatcaaccacttctcaggtggacatctgacagtgaccggtcccacagccactgctggc
atttttgccacctaccctcccagtcacatgacgttgtggtggggcttcctcaatgaggta
ttgttgacaggattgctccagctgtgtctctttgccatcatggacaagcagaacaaccca
gcaatggaagggacacaggccctggtgattggcatcctggttgtcatcattggggtgtcc
ctaggcatgaacacaggatatgccatcaacccatcccgggacctgcctccccgctttttc
acctttattgctggctgggggagtgaagtcttcaggtggcatcatctacctgctcttcct
tggctccaacaccccacgggaaccaaagactccgatggagcccaagatgtatga

DBGET integrated database retrieval system