KEGG   Loxodonta africana (African savanna elephant): 100676988
Entry
100676988         CDS       T04351                                 

Gene name
ABL2
Definition
(RefSeq) Abelson tyrosine-protein kinase 2 isoform X4
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100676988 (ABL2)
   04014 Ras signaling pathway
    100676988 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100676988 (ABL2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100676988 (ABL2)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  ABL family
   100676988 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 100676988
NCBI-ProteinID: XP_003410916
LinkDB
Position
Unknown
AA seq 1064 aa
MVLGTALLPSNSYGRDQDTSLCCLCSGASESALPNLTDHFASCVEDGFEGDKTGGSSPEA
LHRPYGCDVESQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLR
VLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSF
LVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVADGL
VTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGIWKKYSLTVA
VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRE
CSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMT
GDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVY
DLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEE
LGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASTSAPGFIRSAQ
APSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREM
ENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVGRANDTLPKKSE
EGAAPTRERPKAKLLPRGATALPLRAPSGDPAITEKDSPGQGVAGVAVAPKSKERNGGAR
LGMAGVPEDGEQPGWSSPAKVATVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKF
KLLSEHQVTTSGDKDRPRRVKPKCAPPPPPVMRLLQHPSTCSDPSEEPSASSAGQPTTET
QEGGKKAASGAMPVSGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQATEK
ISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFRE
AVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
NT seq 3195 nt   +upstreamnt  +downstreamnt
atggtccttgggacagccctgcttccatctaacagttatggccgggatcaggacacatct
ctttgctgcctgtgtagtggggcctcagaatcagctctacccaacctgacagatcacttt
gccagctgtgtggaggatggatttgagggagacaagactggaggcagtagtccagaagcc
ttgcaccgcccctatggttgtgatgttgaatcccaggcactgaacgaagccatcaggtgg
agctccaaggagaacttgctcggagccactgagagtgaccctaatctctttgttgcactt
tatgattttgtagcaagtggtgataacacactaagcatcactaaaggtgaaaagctacga
gtccttggttacaaccagaatggtgagtggagtgaagttcgctctaagaatggacagggt
tgggtgccaagcaactatatcaccccggtgaacagcctggaaaaacattcctggtaccac
gggcctgtgtcccgcagtgcagcggagtatctactgagcagtctaatcaatggcagtttc
ctggtgcgagaaagtgagagcagccctgggcagctctctatctcgctcaggtatgagggg
cgtgtgtatcactacaggatcaataccaccacagatggcaaggtttacgtgactgccgaa
agccgctttagcaccttggcagagcttgttcaccatcactccaccgtggctgatgggctg
gtgacaacattacactacccagcacccaagtgtaataagcctactgtctatggtgtgtcc
cccatccacgacaaatgggaaatggaacgaacagatattaccatgaagcacaaacttggg
ggtggtcagtatggagaggtttacgttggcatctggaagaaatacagccttacagttgct
gtgaaaacattgaaggaggataccatggaggtagaggagttcctgaaagaagctgcagta
atgaaggaaatcaagcatcctaatctggtacaactattaggtgtgtgtaccttggagcca
ccgttttacatcgtgactgagtacatgccgtacgggaacctgctcgattatctccgagag
tgcagtcgagaagaggtgactgcagttgtgctgctctacatggccactcagatctcttct
gcaatggagtacttagaaaagaagaactttatccatagagatcttgcagctcgtaactgc
ttagtgggagaaaaccatgtggtaaaagtggctgacttcggcttaagtagattgatgact
ggagatacctatactgctcatgcgggagccaaatttcctattaagtggacagcaccagag
agtcttgcctacaataccttctcaatcaaatctgatgtttgggcttttggggtgctcctg
tgggaaattgctacatatggaatgtcaccatatccaggtattgacctgtctcaggtctat
gatctactagaaaaaggatatcgaatggaacaaccagaaggatgcccccctaaagtttat
gaacttatgagagcatgctggaagtggagccctgctgacaggccttcttttgctgagacg
catcaagcttttgaaactatgtttcatgactccagtatttctgaggaggtagctgaggaa
cttgggagagctgcctcctcctcatctgttgttccatacctgccccgattacctatactt
ccttccaagacccggacactgaagaaacaggtggagaacaaggagaacattgaaggggca
caagatgccacagagaattctgcctccacttctgcaccagggttcattagaagtgcacag
gcccccagtgggtccccagcactgcctcgaaagcaaagagacaagtcacccagcagcctc
ttggaagatgccaaagagacatgcttcaccagggataggaaaggaggcttcttcagctcc
ttcatgaaaaagagaaatgctcccacaccccccaaacgcagcagctccttccgagaaatg
gagaatcagccccacaagaaatatgagctcacggggcttccagagcaggataggatggca
atgactcttcccaggaactgccagaggtccaaacttcagctggaaaggacagtgtccacc
tcttctcagccagaagagaatgtgggcagggccaatgacacacttcccaaaaagtcagag
gaaggtgctgctccaaccagggagagaccaaaagccaaacttttgcccagaggagccaca
gctcttcctctcagagccccctctggggatccagccatcacagagaaggactctccaggg
cagggggtggctggagtggcagttgcccccaagagcaaggagaggaatggtggggcacga
ctcgggatggctggagttccagaggatggagagcagccagggtggtcctctccagccaag
gtggcaacagtccttccaaccactcacaaccacaaagtgccagtccttatctcacccact
ctgaaacacactccagctgatgtgcagctcattggcacagactctcaggggaacaagttc
aagctcttatctgagcatcaggtcaccacctctggagacaaggaccgaccccgacgggta
aaaccaaagtgtgccccacccccaccaccagtcatgagactactgcagcatccgtccaca
tgctcagatccttcagaagagccatctgcctcttctgcaggacagcctacgacagaaacc
caggaaggtgggaaaaaggcagcatcaggggcaatgcctgtaagtgggaaagctgggagg
ccagtgatgcctccgcctcaagtgcctctgcccacatcttccatctcgccagccaaaatg
gccaacggcacagctggtactaaagtggctctgagaaaaaccaaacaggcaactgagaaa
atctcagcagacaaaatcagcaaagaagccctgctggaatgtgctgacctactgtccagt
gcaatcacggaacctgtgcccaatagccagctggtggacactggccaccagctgctcgac
tactgctcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagag
gccgtgagcaaactggaactcagcctgcaggagctgcaggtgtcttcagcagctgctggt
gtccccggggcaaaccctgtccttaataacttattgtcatgtgtacaggagatcagtgat
gtggtgcagaggtag

KEGG   Loxodonta africana (African savanna elephant): 100677152
Entry
100677152         CDS       T04351                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04110  Cell cycle
lav04360  Axon guidance
lav04722  Neurotrophin signaling pathway
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05220  Chronic myeloid leukemia
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100677152 (ABL1)
   04014 Ras signaling pathway
    100677152 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100677152 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100677152 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100677152 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677152 (ABL1)
   05206 MicroRNAs in cancer
    100677152 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100677152 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100677152 (ABL1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100677152 (ABL1)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  ABL family
   100677152 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100677152
NCBI-ProteinID: XP_003407604
UniProt: G3SZ92
LinkDB
Position
Unknown
AA seq 1142 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGVRGVAST
LLQAPELPTKTRTSRRAAEHKDSADVPETPHSKGQGESDPLDHEPTVSPLLPRKERGPQD
ASLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKGGGEEEGQEI
SNGALAVMPSDTTEPSKSPKPSNGTSVPNGAFRSPHLWKKSNMLTSNRLAASEEESGSSS
SKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRASE
NRSDQVTRGTVTPPPRLVKKNEETADEVFKDTTESSPGSSPPSLTPKLVRRQVMMAPSSG
HPQKEEAGKSSALGTSVTAEPVPPTSRAGSGASGGGTKAPTEESRVRRHKQPSESPGRDK
GKVSRLKPAPPPPPPASVGKAGKSSQSPSHEAAGEAGAGAKAKSMTLGVDAVSSEATKPN
QLGEGIKKPVLPSIPKPQSSTKPSGTPTSPAPASSSLPSASSSLGGDQQSSTAFIPLIST
RVSLRKTRQLPERIASGTITKGVVLDSTNALCLTISKNSEQMASHSAVLEAGKNLYTFCV
SYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIV
QR
NT seq 3429 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaacgaaggccaagtttgcctgccctg
cactttatcaaaggagcagggaagaaggaatcatcgaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagaggccggtagcatcagattttgagccccaaggt
ctgagcgaagcagctcgttggaactccaaggaaaaccttcttgctggtcccagtgaaaat
gaccccaaccttttcgttgcactgtatgattttgtggccagtggggataatactctaagc
ataactaaaggtgaaaagctccgggtcttaggctacaatcacaatggtgaatggtgtgaa
gcccaaaccaaaaatggccaagggtgggttccaagcaactacatcacgcctgtcaacagt
ctggagaaacattcctggtaccatgggcctgtgtcacgcaatgctgctgaatacctactg
agcagcggaataaatggcagcttcttggtgcgagagagcgagagcagtcctggccagagg
tccatctcgctgagatatgaaggaagggtgtaccactacaggatcaacactgcatctgat
ggcaagctctacgtctcctcagagagccgctttaatactttggccgagttggttcatcac
cattcaacagtggcagacgggctgattaccactctccattatccagcccccaagcgcaac
aagcccactgtctatggtgtgtcccccaactatgacaagtgggagatggaacgcacagac
atcaccatgaagcacaaactgggaggaggccagtatggggaggtgtatgaaggagtgtgg
aagaaatatagcctgacggtggcagtaaagaccttgaaggaggataccatggaggtggaa
gagttcttgaaagaagctgcagtaatgaaagagatcaaacaccctaatctagtgcagtta
ctcggcgtctgtacccgggagcccccgttctacataatcaccgagttcatgacctatggg
aacctgttggattacctgagggagtgcaatcggcaggaggtgaatgctgtggtgctactg
tatatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatccac
agggatcttgctgcccgaaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggttaatgacaggtgatacctacacagcccacgccggagccaagttc
ccgatcaaatggaccgccccagaaagcctggcctacaacaagttttccattaagtctgat
gtctgggcatttggagtattgctttgggaaatagctacctatggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctactggaaaaagactatcgcatggaacgcccg
gaaggctgcccagagaaagtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgtttcaggaatccagc
atatcggatgaagtggaaaaggaactggggaaaaaaggcgtacgaggtgttgcaagtact
ttgctgcaggccccagagctgcccaccaagacgagaacctccaggagagctgcagagcac
aaagactcggctgacgtgcctgagacgccccactccaagggccagggagagagtgatcct
ctggaccatgagcccactgtgtccccattgctccctcggaaagagcgaggtccccaggat
gccagcctaaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagc
gccttaatcaaaaagaagaagaaaacagcccccacccctcccaaacgcagcagctccttc
cgtgagatggacggccagccagagcgcaaggggggcggtgaggaagagggccaagaaatc
agcaacggggcgctggctgtcatgccctcagacacaaccgagccaagcaagtccccaaag
cccagcaatgggaccagcgtccccaatggagccttccggtctcctcatctgtggaaaaag
tccaacatgctgaccagcaaccgattagcagccagtgaagaggagagtggcagcagctcc
agcaagcgcttcctaagatcctgctctgcctcctgtgtgccccacggagccaaggacaca
gagtggaggtcagtcacactgcctcgggatttgcagtccacaggaagacagtttgactcg
tccacatttggagggcacaaaagtgagaagccagccttgcctcggaaacgggcaagtgag
aacaggtctgaccaggtgaccaggggcacagtgacacccccacccagactggtgaagaag
aacgaggaaacagctgatgaggtcttcaaagataccacagagtccagcccaggctccagt
cctcccagtttgactccgaaacttgttcgcaggcaagtcatgatggctccttcctctggc
catccccagaaggaagaggccgggaaatccagtgccttagggacctctgtcacagctgag
ccagttccccccaccagcagagcagggtcaggtgcatctggaggtggcaccaaggcccct
actgaggagtccagagtaaggaggcacaagcagccctccgagtctccggggagagacaag
gggaaagtgtccaggctcaaacctgccccaccgcccccacccccagcctctgttgggaaa
gctggaaagtcctctcagagcccgagccatgaagcagctggggaggcaggagccggtgct
aaagcaaaatccatgaccctgggtgtggatgctgtgagcagtgaggctaccaagccaaac
cagctaggagagggcatcaaaaagcctgtgctcccttccataccaaagccacagtcatct
accaagccatcggggaccccaaccagcccagcccctgcttcctcatcattgccgtcagca
tcctcatccctgggaggggaccagcagtcctccactgccttcatccctctcatctctaca
cgtgtctctcttcggaaaacccggcagcttccggagcggattgccagtggcaccattacc
aagggtgtggtcctggacagcaccaatgccttgtgcctcaccatctccaagaactctgaa
cagatggccagccacagtgcagtgctggaagctggcaaaaacctctacacgttctgtgtg
agctacgtggattctatccagcaaatgaggaacaaattcgccttccgtgaggccatcaac
aaactggagaacaatctccgggagcttcagatctgcccggcgactgcggggagtggccca
gccgccactcaggactttagcaaactcctcagctcagtgaaagaaatcagtgacatcgta
cagaggtag

DBGET integrated database retrieval system