KEGG   Loxodonta africana (African savanna elephant): 100676989
Entry
100676989         CDS       T04351                                 

Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04713  Circadian entrainment
lav04911  Insulin secretion
lav04921  Oxytocin signaling pathway
lav04972  Pancreatic secretion
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100676989
   04020 Calcium signaling pathway
    100676989
   04024 cAMP signaling pathway
    100676989
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100676989
   04921 Oxytocin signaling pathway
    100676989
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100676989
   04261 Adrenergic signaling in cardiomyocytes
    100676989
  09154 Digestive system
   04972 Pancreatic secretion
    100676989
  09159 Environmental adaptation
   04713 Circadian entrainment
    100676989
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100676989
   05022 Pathways of neurodegeneration - multiple diseases
    100676989
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676989
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100676989
   05414 Dilated cardiomyopathy
    100676989
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100676989
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100676989
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100676989
Domain-containing proteins not elsewhere classified [BR:lav04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100676989
SSDB
Motif
Pfam: RIH_assoc RR_TM4-6 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 YjfB_motility
Other DBs
NCBI-GeneID: 100676989
NCBI-ProteinID: XP_023405079
LinkDB
Position
Unknown
AA seq 1426 aa
MKTGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPRGVTQIINYTTVALLPML
SSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYTLGTSKSIYVERQRSALGECLAAFAGA
FPVAFLETHLDKHNVYSIYNTKSSRERAALNLPSNVEDVCPNIPSLEKLMDEIVELAESG
IRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIY
NNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAALVVSEEDHMKAEAR
GDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIY
WSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSL
IVAALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRNNIHLQGKLEDPAIR
WQMALYKDLPNRTEDTSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKR
AVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEG
TKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEHD
IIKDLRNKFASLGENSLEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAAT
LKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLG
MVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYL
LRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHS
RLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQ
MVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHY
TQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTF
LELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVN
EGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSTNKEESEKEKPEEQEPRMGFFSI
RTVKSALFALRYNILTLMRMLSLKSLKKQMKKMKKMTMKDMVTAFFSSYWSIFLNLLHFV
ASVFRGFFRIVCSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEDGERKPMEVAL
PSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQEK
FQEQKAKEEEKEEKEETKSEPEKAEYVWFLYALPCFRKSPFLVLSL
NT seq 4281 nt   +upstreamnt  +downstreamnt
atgaagactggcctggagagtgttaaaagtgcccttcgagcatttctggacaatgcagct
gaggacctggagaagacgatggaaaaccttaagcagggccagttcacacacacccgaaac
caacccagaggtgtcactcagattatcaactataccacggtggcactgctgccaatgctc
tcatcgttatttgaacatattggccagcatcagttcggagaagatctaatattggaagac
gtgcaggtctcctgttacagaatcctgactagcttatacactttgggaaccagcaagagc
atctatgtggagaggcaacgttctgcattaggagaatgtctggctgcctttgctggtgcc
tttccggtagcatttttggaaacccatcttgacaaacataatgtttactctatctacaac
accaagtcttcacgagagagagcagctcttaatttgccatctaacgtggaagatgtttgt
cctaacataccgtctttggagaaactcatggacgagattgtggaattagccgagtctggc
attcgctacacacaaatgccacatgtaatggaagttatactgcccatgctttgcagctac
atgtctcgttggtgggagcacggacctgagaacaatccggaaagagctgaaatgtgctgc
actgctctgaactcagagcacatgaacacacttcttggaaatatattgaaaattatatat
aataacttgggaattgacgaaggggcctggatgaagaggttagcagtgttttcccagcct
attataaacaaagtgaaacctcagctcttgaaaactcacttcttgccattaatggagaaa
ctcaagaaaaaggcagccttagtggtatccgaggaagatcatatgaaagccgaggccaga
ggcgatatgtcggaggcggaactcctcattctagatgagttcaccacgctggccagagac
ctgtatgccttctaccctctcctgattagattcgtggactacaacagggcaaagtggcta
aaagagcctaacccggaagcagaggaactcttccgtatggtggccgaagtgtttatctac
tggtcaaaatcccataatttcaaaagagaagagcagaacttcgtggtacagaatgaaatc
aacaatatgtctttccttattactgacaccaagtcaaagatgtcaaaggcagctgtttct
gatcaggaaaggaagaaaatgaaacgtaaaggagaccggtattctatgcagacctctctg
atcgtagcagctctgaagcgactgctgcccattggattgaacatctgtgcccctggggac
caggagctcattgctctggccaagaatcgatttagtctgaaagacaccgaggatgaagta
cgagacataatccgcaataatattcatttacaaggcaagctagaggaccctgctattaga
tggcaaatggctctttacaaagatttaccaaacaggactgaagatacttcagacccagag
aagaccgtagaaagagtattggatattgcaaatgtcctttttcatcttgaacaggtggaa
caccctcagaggtctaagaaggcagtgtggcacaaactgctgtctaagcagaggaaacga
gcagtggtcgcctgcttccgaatggctcccttatacaatctaccaaggcatcgagctgtc
aatctctttcttcagggatatgaaaagtcttggattgaaacagaagaacattactttgaa
gataaactgatagaagatttagcaaaacctggagcagaacctccagaagaagatgaaggc
actaagagagttgaccctctccatcagctgatccttctgtttagtcgaacagctttaaca
gagaaatgcaaactggaggaagattttttatatatggcttatgcagatattatggcaaag
agttgtcatgatgaggaagatgatgatggtgaagaagaagtgaagagttttgaacacgat
attatcaaagatttaagaaacaaatttgccagcctcggcgagaactctctggagaaagaa
atggaaaagcagaagcttctctaccagcaagccagactccacgatcgaggcgctgctgag
atggtactgcagaccatcagtgccagcaaaggtgaaatggggccaatggtagctgctact
ttgaaacttggaattgccatcttaaatggtgggaactcaacagtacagcagaaaatgcta
gactacctcaaggagaagaaggacgtgggcttctttcagagcctcgctggtctgatgcag
tcatgtagtgtccttgacctaaacgcatttgagcgacaaaacaaagctgaaggactcgga
atggtgacggaggaaggatcaggagagaaggtgctgcaggatgacgagttcacctgtgac
ctcttccgcttcctccagcttctttgtgagggacacaattcagattttcagaattatctg
agaactcagactggcaataacacaactgtcaatataatcatctctactgtggactaccta
ctgagagttcaggaatcaattagtgatttctattggtattactctgggaaagatgttatt
gatgaacaaggacaacggaatttctccaaagcaattcaagtagcaaaacaagtctttaac
actctgacagagtatattcagggtccctgcactgggaatcagcagagtttggcacacagc
aggctatgggatgccgtggtgggttttcttcacgtctttgcacacatgcaaatgaagctg
tctcaggattccagtcaaattgagctattaaaagaattaatggatcttcagaaggatatg
gtggtcatgttgctgtccatgttagaaggtaatgttgttaatggaacgattggcaaacag
atggttgatatgcttgtggaatcgtctaacaacgtagagatgattctcaaattttttgac
atgttcttaaaactaaaggatttgacatcttctgataccttcaaagaatatgaccctgat
ggcaagggagtcatttccaagagggacttccataaagcaatggagagccataagcactac
acacagtcagaaacggaatttcttttgtcctgcgcggagacagatgaaaatgaaaccctg
gactacgaggagtttgtaaaacgattccatgaacccgcaaaggacattggcttcaatgtg
gccgtcctcctgacgaatctttcagagcacatgcccaatgatacccgactgcagactttc
ctcgaattagcagagagtgtgctgaattatttccagccctttctgggccgcattgagatc
atgggaagtgctaagcgcatcgagagggtttattttgaaatcagtgagtctagccggacc
cagtgggagaagccccaggtcaaagaatccaaaaggcagttcatatttgacgtggtcaat
gaaggaggagaaaaagagaagatggaactttttgtgaacttctgtgaggacaccatattt
gaaatgcaactggcagctcagatctcagagtcagatttgaatgagaggtccacgaataaa
gaagaaagtgagaaggagaagcccgaagagcaggagccaagaatgggtttcttttctatt
cggacggtcaaatcggccctgtttgccctcaggtataatatcttgacccttatgagaatg
ctcagtctgaaaagcctgaagaagcagatgaagaaaatgaagaagatgaccatgaaggac
atggtcacggccttcttttcatcctattggagtatttttttgaacctcttgcactttgta
gccagtgttttcagaggctttttccgcatcgtttgtagcctgctactgggaggaagccta
gtagaaggtgctaaaaagatcaaagttgcggaactcttagccaatatgccggaccccact
caggatgaggtgagaggagacggagaggatggagagaggaaacccatggaagttgccctg
ccctctgaagacctgacagacttaaaggaactgacagaggaaagtgaccttctttcggac
atatttggcttggatctgaagagagaaggaggacagtacaaacttattcctcataatccc
aatgctggccttagtgacctaatgagcaacccagtccccatccctgaagtgcaagaaaaa
tttcaggaacagaaggcaaaagaagaagaaaaggaagaaaaagaagaaaccaaatctgaa
cctgagaaagctgagtatgtatggtttctgtatgctttgccttgtttcaggaagtctcct
tttcttgtgctctctctttga

DBGET integrated database retrieval system