KEGG   Loxodonta africana (African savanna elephant): 100676992
Entry
100676992         CDS       T04351                                 

Gene name
CHRM4
Definition
(RefSeq) muscarinic acetylcholine receptor M4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04725  Cholinergic synapse
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100676992 (CHRM4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100676992 (CHRM4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100676992 (CHRM4)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    100676992 (CHRM4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100676992
NCBI-ProteinID: XP_003412306
UniProt: G3UHX9
LinkDB
Position
Unknown
AA seq 478 aa
MANFTPDNGSSGNQSVRLVTSTHNRYETVEMVFIATVTGSLSLVTVVGNVLVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHQPEGPKEKKTKT
LAFLKSPLMKQSVKKPPTGEATREDLRNGKLEEAPPPALPPPLRPMTEKDTSNESSSGSA
TQNTKERPPTELSTTEATVPATPAPSRQPRALNPASKWSKIQIVTKQTGNECVTAIEIVP
ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL
VNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTTR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcaaacttcacaccagacaatggtagctcaggcaaccagtctgtgcgcctggtcact
tcaacgcataaccgctatgagacggtagagatggtgtttattgccacagtgacaggctcg
ctgagcctggtgactgtcgtagggaacgtcttggtgatgctttccatcaaggtcaacagg
cagctgcagacagtcaacaactacttcctattcagcttggcatgtgctgatctcatcata
ggcgccttctccatgaacctctataccgtgtacatcatcaagggctactggccgctgggt
gctgtggtctgtgacctgtggctggccctggactatgtggtgagcaatgcctcagtcatg
aatcttctcattatcagctttgaccggtacttctgcgttaccaagcccctcacctaccca
gcccgacgcaccaccaagatggcaggcctcatgatcgctgctgcgtgggtcctgtccttc
gtgctctgggcgcctgccatcttgttctggcagtttgtggtgggcaagaggacagtgcct
gacaaccagtgtttcattcagttcctgtccaacccagcggtgacctttggtacagccatt
gctgccttctacctgcccgtggtcatcatgacggtgctctacattcacatctccctggcc
agtcgcagccgggttcacaagcaccagcctgaaggccccaaggagaagaagaccaagacc
ttggccttcctcaagagccctctgatgaagcagagcgtcaagaaaccccccacaggagaa
gccactcgagaagacctgcgcaatgggaagctagaggaggcccctccaccagctctgcca
cccccactgcgtccaatgactgagaaagacacttccaatgagtccagctcaggcagcgcc
acccagaacaccaaggaacgaccacccacagagttgtccactacagaggccacggtacct
gccacacccgccccttcccgacagccacgtgccctcaacccggcttctaaatggtccaag
atccagattgtgacgaagcagacaggcaacgagtgtgtgacagccatcgagattgtgcct
gccacgccagctggcatgcgtccagcggccaatgtggcccgcaagtttgccagcattgcc
cgcaaccaggtgcgcaagaagcggcagatggcagcccgggagcgcaaggtgactcggacc
atctttgccatcctgttggccttcatcctcacctggacaccctacaacgtcatggtcctg
gtgaacaccttctgccagagctgtatccctgacacggtgtggtccattggctactggctc
tgctatgtcaacagcaccatcaaccctgcctgctatgccctctgcaacgccacctttaaa
aagactttcagacacctgctactatgccagtatcggaacatcggcaccaccaggtag

DBGET integrated database retrieval system