KEGG   Loxodonta africana (African savanna elephant): 100677095
Entry
100677095         CDS       T04351                                 

Gene name
GPER1
Definition
(RefSeq) G-protein coupled estrogen receptor 1
  KO
K04246  G-protein coupled estrogen receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04915  Estrogen signaling pathway
lav04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100677095 (GPER1)
   04915 Estrogen signaling pathway
    100677095 (GPER1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100677095 (GPER1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Others
   Estrogen
    100677095 (GPER1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100677095
NCBI-ProteinID: XP_010594551
LinkDB
Position
Unknown
AA seq 364 aa
MEGYLGTTQPVTPNDTLMDLGEARLLDGAALANHTRALQEHQQYVIGLFLSCLYTIFLFP
IGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDITVLCT
FMSLFLQINMYSSIFFLTWMSFDRYVALARAMRASLFRTKQHARLSCGLIWLASASATLV
PFTAVHLQHTKEACFCFADVREVQWLEVTLGFLVPLAIIGLCYSLIARVLVGAHRHRGLR
PRRQKALRMIFAVVLVFFICWLPENVFICVHLLQRPQPGASSCKQSFRHAYPLTGHIVNL
AAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNMSALNRFCHAALKSVMPDSTEPSDVKF
SSAV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggagggctatctgggcaccacacagcctgtcacccccaacgacaccctcatggacctg
ggcgaggcacgcttgctggacggtgcggccctggcgaaccacacccgtgccctgcaggag
caccagcagtacgtcatcggcctctttctctcctgtctctacaccatcttcctcttcccc
atcggcttcgtaggcaacatcctgatcctggtggtaaacatcagcttccgcgagaagatg
accatccctgacctatacttcatcaacctggctgctgctgacctcatcctggtggccgac
tcgctcatcgaggtgttcaatctggacgagcagtactacgacatcactgtgctctgcacc
tttatgtcactcttcctgcagatcaacatgtacagcagcatcttcttcctcacctggatg
agcttcgaccgctacgttgccctggcccgggccatgcgcgccagcctcttccgcaccaag
cagcacgcgcggctgagctgcggcctcatctggctggcctcggcctcagccacgctggtg
cccttcacagccgtgcacctgcagcacaccaaggaggcctgtttctgctttgccgacgtg
agggaggtccagtggctggaggtcaccctaggcttcctcgtgcccttggccatcattggc
ctctgctactcgctcattgcacgggtgcttgtgggtgcacaccggcaccgcggcctgcgg
ccccggcgacagaaggcgctgcgcatgatctttgcagtggtcctcgtcttcttcatctgc
tggctgccagagaatgtcttcatttgcgtgcacctgctgcagcgtccgcagccaggagca
tcctcctgcaagcagtctttccgccatgcctaccccctgaccggccacatcgtcaacctt
gcggccttctccaacagctgcctgaaccccctcatttacagctttctcggggagaccttc
agggacaagctgaggctgtacatcgagcagaagacaaacatgtcggccctgaaccgtttc
tgccatgccgccctgaagtcggtgatgccggacagcacggagccatcagatgtaaagttc
agcagtgcagtgtga

DBGET integrated database retrieval system