KEGG   Loxodonta africana (African savanna elephant): 100677125
Entry
100677125         CDS       T04351                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor isoform X2
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04064  NF-kappa B signaling pathway
lav04071  Sphingolipid signaling pathway
lav04150  mTOR signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04350  TGF-beta signaling pathway
lav04380  Osteoclast differentiation
lav04612  Antigen processing and presentation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04640  Hematopoietic cell lineage
lav04650  Natural killer cell mediated cytotoxicity
lav04657  IL-17 signaling pathway
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04920  Adipocytokine signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04940  Type I diabetes mellitus
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05310  Asthma
lav05321  Inflammatory bowel disease
lav05322  Systemic lupus erythematosus
lav05323  Rheumatoid arthritis
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100677125 (TNF)
   04350 TGF-beta signaling pathway
    100677125 (TNF)
   04064 NF-kappa B signaling pathway
    100677125 (TNF)
   04668 TNF signaling pathway
    100677125 (TNF)
   04071 Sphingolipid signaling pathway
    100677125 (TNF)
   04150 mTOR signaling pathway
    100677125 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100677125 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100677125 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100677125 (TNF)
   04217 Necroptosis
    100677125 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100677125 (TNF)
   04620 Toll-like receptor signaling pathway
    100677125 (TNF)
   04621 NOD-like receptor signaling pathway
    100677125 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100677125 (TNF)
   04625 C-type lectin receptor signaling pathway
    100677125 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100677125 (TNF)
   04612 Antigen processing and presentation
    100677125 (TNF)
   04660 T cell receptor signaling pathway
    100677125 (TNF)
   04657 IL-17 signaling pathway
    100677125 (TNF)
   04664 Fc epsilon RI signaling pathway
    100677125 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100677125 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100677125 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100677125 (TNF)
  09163 Immune disease
   05310 Asthma
    100677125 (TNF)
   05322 Systemic lupus erythematosus
    100677125 (TNF)
   05323 Rheumatoid arthritis
    100677125 (TNF)
   05321 Inflammatory bowel disease
    100677125 (TNF)
   05330 Allograft rejection
    100677125 (TNF)
   05332 Graft-versus-host disease
    100677125 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100677125 (TNF)
   05014 Amyotrophic lateral sclerosis
    100677125 (TNF)
   05020 Prion disease
    100677125 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100677125 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100677125 (TNF)
   05410 Hypertrophic cardiomyopathy
    100677125 (TNF)
   05414 Dilated cardiomyopathy
    100677125 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100677125 (TNF)
   04940 Type I diabetes mellitus
    100677125 (TNF)
   04932 Non-alcoholic fatty liver disease
    100677125 (TNF)
   04931 Insulin resistance
    100677125 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100677125 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100677125 (TNF)
   05135 Yersinia infection
    100677125 (TNF)
   05133 Pertussis
    100677125 (TNF)
   05134 Legionellosis
    100677125 (TNF)
   05152 Tuberculosis
    100677125 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100677125 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100677125 (TNF)
   05161 Hepatitis B
    100677125 (TNF)
   05160 Hepatitis C
    100677125 (TNF)
   05171 Coronavirus disease - COVID-19
    100677125 (TNF)
   05164 Influenza A
    100677125 (TNF)
   05168 Herpes simplex virus 1 infection
    100677125 (TNF)
   05163 Human cytomegalovirus infection
    100677125 (TNF)
   05169 Epstein-Barr virus infection
    100677125 (TNF)
   05165 Human papillomavirus infection
    100677125 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100677125 (TNF)
   05144 Malaria
    100677125 (TNF)
   05145 Toxoplasmosis
    100677125 (TNF)
   05140 Leishmaniasis
    100677125 (TNF)
   05142 Chagas disease
    100677125 (TNF)
   05143 African trypanosomiasis
    100677125 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100677125 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100677125 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100677125 (TNF)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Tumor necrosis fators
   100677125 (TNF)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Cytokines
   100677125 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100677125
NCBI-ProteinID: XP_003422261
LinkDB
Position
Unknown
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGAPQDSRRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQG
EEFSDGFHLINPLAQTLRSSSRDPSDKPVAHVVANPQTEGQLQWLSRRANTLLANGVELI
DNQLMVPSDGLYLIYSQVLFKGQGCPATQVLLTHTISRIAVSYKTKVNLLSAIKSPCHRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgttgagctggccgaagaggcactccccaagaag
gcaggggccccccaggactccagacggtgcctgtgcctcagccttttctccttcctgctt
gtggcaggagccaccacgctcttctgcctgctgcacttcagggtgatcggcccccagggg
gaagagttctcagatggattccatctaatcaaccccttggcccagacgctcagatcatct
tctcgagatccaagtgacaagcctgtagcacacgttgtagcaaacccccaaaccgagggg
caacttcagtggctgagccggcgtgccaataccctcctggccaatggtgtggagttgata
gacaaccagctgatggtgccttccgatgggctgtacctcatctactcccaggtcctcttc
aagggccaaggctgtcctgccacccaagtgctcctcacccacaccatcagccgtatcgct
gtctcctacaagaccaaggtcaacctcctctctgccatcaagagcccctgccatagggag
accccagagggggctgaggccaagccctggtatgagcccatctacctgggaggagtcttc
cagctagagaagggtgatcgactcagcgctgagatcaatctgcctgactatctcgacttt
gctgagtctgggcaggtctactttgggatcattgccttatga

DBGET integrated database retrieval system