KEGG   Loxodonta africana (African savanna elephant): 100677158
Entry
100677158         CDS       T04351                                 

Gene name
ESR2
Definition
(RefSeq) estrogen receptor beta
  KO
K08551  estrogen receptor beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04929  GnRH secretion
lav05200  Pathways in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100677158 (ESR2)
   04915 Estrogen signaling pathway
    100677158 (ESR2)
   04917 Prolactin signaling pathway
    100677158 (ESR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677158 (ESR2)
  09162 Cancer: specific types
   05224 Breast cancer
    100677158 (ESR2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100677158 (ESR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100677158 (ESR2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100677158 (ESR2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100677158 (ESR2)
Nuclear receptors [BR:lav03310]
 3. Estrogen like
  3A. Estrogen receptor
   100677158 (ESR2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100677158
NCBI-ProteinID: XP_003408751
UniProt: G3TJL2
LinkDB
Position
Unknown
AA seq 547 aa
MSFRASSHKEFSQLLPVQDMDIKNSPSSLNSPVSYNCSQSVLPLEHGPIYIPSSYVESHH
EYSAMTFYSPTVMNYSIPSSANNSEGGPGRQATSPNVLWPTPGHLSPLAIHCQSSLLYAE
PQKSPWCEARSLEHALPINRETLKRKVSGSSCTSPVTSPSSKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
EKCGYRVVRRQRNPKEQLHCLSKAKKNDGNATRGKELLLNALSPEQLVLTLIEAEPPNVL
VSRPTSPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLILDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVK
AMILLNSSMYPLAAATQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLML
LSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHSLRGYKPSGSECSPAEESKNKGS
CQAPQSQ
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtcctttcgtgcctcttcacacaaggagttttctcagttattacctgttcaagatatg
gatatcaaaaactcaccgtccagccttaactctcctgtctcctacaactgcagtcagtct
gtcctacccctggagcatggccccatatatatcccttcctcctatgtagaaagccaccat
gaatattcggccatgacattctatagccccactgtgatgaattacagtatccccagcagt
gccaataactcggaaggtgggcctggtcgacaggccacaagcccaaatgtgttgtggcca
actcctgggcacctctctcctttggcgatccattgccagtcgtcacttctgtacgcagaa
cctcaaaagagtccgtggtgtgaagcaagatcactagaacacgccttacctataaacaga
gagacactgaaaaggaaagttagcgggagcagttgcaccagccctgttaccagtccaagc
tcaaagagagatgctcacttctgtgcggtctgcagcgattatgcttcgggatatcactac
ggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacataat
gattatatttgcccagccacaaatcagtgtacgatagataagaaccggcgcaaaagctgc
caggcctgccgacttcggaagtgctatgaagttggaatggtgaagtgtggctctcggaga
gaaaagtgtgggtaccgtgtagtccgaaggcagagaaaccccaaagaacagctgcattgc
ctgagcaaagcaaagaaaaatgatggaaatgcgacccgagggaaagagctactgctgaac
gccctgagcccggagcagctggtgctcacgctcattgaggctgagccgcccaatgtgctc
gtgagccgccccacctcacccttcaccgaggcctccatgatgatgtccctgaccaagctg
gccgacaaggaattggtgcacatgattggctgggccaagaaaattcccggctttgtggag
ctcagcctgtacgaccaagtgaggctcttggagagctgctggatggaggtgttaatggtg
gggctgatgtggcgctcaatcgaccatcctggcaagctcatctttgctccagacctcatt
ctggacagggatgaggggaagtgtgtagaaggaattttggaaatctttgacatgctcctg
gcaacgacttcaaggtttcgcgagttgaaactccaacacaaggagtatctctgtgtcaag
gccatgatcctcctcaactccagtatgtaccctttagctgcagcaacccaggaggcagag
agtagccggaagctgactcacttactgaatgccgtgacagatgctctggtctgggtgatc
gccaagagtggcatctcctcccagcaacagtccgttcgcctggctaacctcctgatgctc
ctttctcacgtcaggcatgccagtaacaaaggcatggaacacctgctcagcatgaagtgc
aaaaacgtggtcccagtctacgacctgctgctggagatgctgaatgcccactcgcttcgg
gggtacaagccctcagggtctgagtgcagtccagccgaggagagtaagaacaaagggagc
tgccaggccccacagtctcagtga

KEGG   Loxodonta africana (African savanna elephant): 100677316
Entry
100677316         CDS       T04351                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor
  KO
K08550  estrogen receptor alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100677316 (ESR1)
   04917 Prolactin signaling pathway
    100677316 (ESR1)
   04919 Thyroid hormone signaling pathway
    100677316 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100677316 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677316 (ESR1)
   05205 Proteoglycans in cancer
    100677316 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    100677316 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100677316 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100677316 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100677316 (ESR1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100677316 (ESR1)
Nuclear receptors [BR:lav03310]
 3. Estrogen like
  3A. Estrogen receptor
   100677316 (ESR1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 ESR1_C Oest_recep
Other DBs
NCBI-GeneID: 100677316
NCBI-ProteinID: XP_010594137
LinkDB
Position
Unknown
AA seq 475 aa
MFCFLNVNGFTVFFFVCLFCFVFSPIFFFSRPNSDNRRQGDRERLASTGDKGNMSMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGGGRNEAGTSGDMRSASLWPGPLLIKH
TKKNSPALSLTADQMVSALLEAEPPLIYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRKMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTNRGGAPMEETNQNQLATMGSTSSHSMQPYYITGEAESLPTTL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgttttgctttttgaatgttaatggattcactgtttttttttttgtttgtttgttttgt
tttgttttttctcccattttttttttttccaggcccaattcagataaccggcgccagggt
gacagagagagattggctagtactggtgacaagggaaacatgtccatggaatctgccaag
gagactcgctactgtgcggtgtgcaatgactatgcctcaggctaccattatggagtttgg
tcctgtgagggctgtaaggccttcttcaagagaagtattcaagggcataatgactacatg
tgtccggccactaaccagtgcacgatcgataagaacaggaggaagagctgtcaggcctgt
cggctacgcaagtgctacgaagttggaatgatgaaaggtgggattcggaaagaccggaga
ggagggagaatgttgaagcacaagcgccagagggatgatgggggaggcaggaatgaagcg
gggacgtctggagatatgagatcagccagcctttggccaggcccgctcttgattaagcac
accaagaaaaacagcccagctttgtccctgacagctgatcagatggtcagtgccttgttg
gaggcagagcctcccttaatctattctgagtacgaccctacccggcccttcagtgaggct
tccatgatgggcttactaaccaacctggctgacagagagctggttcacatgatcaactgg
gccaagagggtgccaggctttgtggatttgaccctccatgatcaggtacaccttctggaa
tgtgcctggctagagattctgatgattggtctcgtctggcgctcaatggagcacccagga
aagctcctgtttgcccccaacttgctgctggacagaaaccaggggaaatgcgtggagggg
atggtggaaatctttgacatgctgctggctacgtcatctcggttccgaaagatgaacctc
cagggagaggagtttgtgtgcctcaaatctatcattttgctgaattctggggtgtacaca
tttctgtccagcactctgaagtctctggaagagaaggaccacatccaccgtgtgctggac
aagatcacagacaccttgatccacctgatggccaaagcaggcctcagtctgcagcagcag
caccggcgcctggcccagctccttctcattctctcccatatcaggcacatgagtaacaaa
ggcatggagcatctctacagcatgaagtgcaagaacgtggtgcctctgtacgacctgctg
ttggagatgctggatgctcaccggctgcatgccccgaccaaccgtgggggcgcccccatg
gaggagaccaaccagaaccagctggctaccatgggttccacttcatcgcattccatgcaa
ccctattacatcactggggaggcagaaagtttgcccaccactctgtga

DBGET integrated database retrieval system