KEGG   Loxodonta africana (African savanna elephant): 100677211Help
Entry
100677211         CDS       T04351                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05034  Alcoholism
lav05165  Human papillomavirus infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100677211 (HDAC6)
  Substance dependence
   05034 Alcoholism
    100677211 (HDAC6)
  Infectious diseases
   05165 Human papillomavirus infection
    100677211 (HDAC6)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100677211 (HDAC6)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100677211 (HDAC6)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100677211 (HDAC6)
Membrane trafficking [BR:lav04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100677211 (HDAC6)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100677211 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100677211
NCBI-ProteinID: XP_010596001
LinkDB All DBs
Position
Unknown
AA seq 1136 aa AA seqDB search
MTSTGQDSTTNRQRRSRHNPHSPSHNSSVISKRGVKKGAVPRSSPSLAEVKKKGRMKKLS
QAAEQDLIMGLQELDLNLEPKALSGTGLVFEEQLNEFHCLWDDSFPECSERLHAIKEQLT
QEGLLDRCISFQARSAKKEELMLVHSLEYIDLMETTQYMNEAELRILANTYDSVYLHPNS
YTCACLASGSVLRLVDAVLGAKVRNGMAVIRPPGHHAQHNLMDGYCMFNHVAVAARYAQQ
KHDIQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEHGQFWPHLKASNWSATGFGRG
QGYNINVPWNQVGMRDADYIAAFLRILLPVALEFQPQLVLVAAGYDALQGDPKGKMAATP
AGFAQLTHMLMGLAGGKLILSLEGGYNYRSLAEGVSASLHTLLGDPCPMLESPGAPCLSA
RTSISCTLVALKPFWEVLMQSAETLEEDCVEKDKEEGPWEPPVPQIMAWPMLCARTGLIY
DRRMMNHYNLWDNHHPEMPQRISRIMCHLEGLGLTERCLTLPARPATDAELLTCHRWGWN
HLTAHQCSSHASSAEYIARLRATENMKTRELHREGANFDSIYICPSTFTCAQLATGAVCR
LVEAVLAGEVLNGTAVVRPPGHHAEWDAACGFCFFNSVAVAARHAQAISGHALRILIVDW
DIHHGNGTQHIFEDDPSVLYMSLHRYDHGTFFPMGNEGASSQIGQAPGVGFTVNVAWNGP
RMGDPDYLAAWHRLVLPIAYEFNPELVLVSAGFDAAQGDPLGGCQVSPEGYAHLTHLLMG
LANGRIILILEGGYNLTSISESMAACTRTLLGDPPPLLGPLRPPLSGALASISETVHVHR
RYWRSLRIRKVEDKEEEPSNSGLVTKKEPQPANPGSAKGMARPEENILEAGMGKATSASP
VEESIPGQAKSEIATVELAKDKSLEVATGGAMLDQTTSEGPVGHTKLASCTDSQTPPSSP
VQGTTPYIFPRNLIESLRTLELSNKTQKAPDSQTPEEKLLGEAAGGQDLDDSKLMGFGDT
DEATFYAVTPLPWCPHLTAVCPIPAAGLDVTQPCQDCGSLQENWVCLSCYQVCCGRYINA
HMIQHHEDLGHPLVLSFVDLSTWCYHCQAYVHHQALLDVKNLAHQNKFGEDMPRPH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggccaagattccaccacaaacagacagcgaaggagtagacacaacccc
cactcaccctcccataactccagcgtcatctcgaagcgtggtgttaaaaagggtgctgta
ccccgctccagccctagtctagcagaggtaaagaagaaaggcagaatgaagaagctcagc
caagcagcagagcaagacctaatcatggggctgcaagagctggatctgaacctggagccc
aaggcactgtctggcacaggcttggtgttcgaagagcagctaaatgaattccactgcctc
tgggatgacagcttccctgaatgctctgagcggctccatgccatcaaggagcagctgacc
caggagggcctcttagatcgctgtatctccttccaggctcggtcagccaaaaaggaggag
ctgatgttggttcacagcctagaatacattgatctgatggagacgacccagtacatgaat
gaggcggaactccgcatcctggcaaacacctatgactcagtctacctgcatccaaactca
tacacctgtgcctgcctagcctcaggctctgtcctcagactggtggatgcagttctgggg
gccaaagtccggaatggcatggctgtcatcaggcctcctggacaccacgcccagcacaat
cttatggatgggtattgcatgttcaaccatgtggccgtggctgcccgctacgctcagcag
aagcatgatattcagagggtccttattgtggattgggatgtgcaccatggtcaaggaaca
cagttcacctttgaccaggaccccagcgtcctgtatttctccatccaccgctatgagcac
ggccagttctggccccaccttaaggcctctaactggtccgccacaggcttcggccgaggt
cagggatacaacatcaatgtgccttggaaccaggtggggatgcgggatgccgactacatt
gctgcgttcctgcgcatcctgctgccagttgcccttgagttccagccacagctggtcctg
gtggctgctggatatgatgccctccaaggggaccccaagggcaagatggctgccactcca
gcagggttcgcgcagctgacccacatgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaactaccgctccctggctgagggcgtcagtgcctcgctccac
acccttctgggagacccttgtcccatgctggagtcccctggtgccccctgcttgagtgcc
cgaacttcgatttcctgcactctggtagccctcaagcccttctgggaggtccttatgcaa
tctgctgagaccctcgaggaggactgcgtggagaaggacaaggaggaggggccgtgggag
ccccctgtgccccaaatcatggcctggccaatgctgtgtgctcgcacagggctgatctat
gaccggcgtatgatgaatcactacaacttatgggacaaccaccaccccgagatgccccag
cgcatctcgcgaattatgtgccatctggaggggctgggcctcactgagcgctgcctcacc
ctgcctgcacgccccgccacagatgccgagctgctcacctgccacaggtggggctggaac
cacctcactgcccaccagtgctcgtctcatgcctccagtgctgagtacatagctcgtctg
cgggccacggagaacatgaagacccgggaactgcaccgtgagggcgccaactttgactcc
atctacatctgccccagcaccttcacctgtgcacagctcgccactggcgctgtgtgccgc
ctagtggaggctgtgcttgctggagaggtactgaatggtactgctgtggtgcgcccacca
ggacaccacgcagagtgggatgctgcttgtggtttctgcttttttaactctgtggctgtg
gctgctcgccatgcccaggccatcagtgggcatgccctgcggatcctgatcgtggattgg
gacatccatcatggtaatggaactcagcacatatttgaggatgaccccagtgtgctctac
atgtcacttcaccgctatgatcatggcaccttcttccccatggggaatgagggtgccagc
agccagattggccaggcccccggtgtaggcttcactgtcaacgtggcctggaatgggccc
cgcatgggtgaccccgactacctggctgcctggcatcgtctggtacttcccattgcctac
gagtttaacccagaactggtgctggtctcagctggctttgacgccgcacagggagacccc
ttggggggttgccaggtgtcacctgaaggctacgcccacctcacccacctgctgatgggc
cttgccaacggccgcattatcctaatcctagagggtggctataacctgacatccatctcg
gagtccatggctgcctgcacccgcaccctccttggggacccaccacccctgctgggccct
ctgaggcccccgctatcaggggcccttgcctcgatctcagagactgtccacgtccatcgc
agatactggcgtagcttgcggatcagaaaggtggaggacaaggaggaggaaccctccaat
tctgggctggtcaccaagaaggagcctcaaccagccaatcctgggtcagccaaggggatg
gccaggccagaagaaaacattctggaagcaggcatggggaaggctacctcagcatcacct
gtggaggagtccattccaggccaggctaagtcagagatagccacggtggagctcgctaaa
gacaagtccttggaggtagccactggtggggccatgctggaccagaccacctcagagggg
cctgtggggcacaccaagctagcttcatgcactgacagccagacccccccatcctcacct
gtgcagggaaccaccccttacatattccccagaaacttgattgagagtctcaggaccttg
gaactaagcaataagactcagaaggccccagattctcagaccccagaagagaagctacta
ggagaggcagctggaggtcaggacttggatgattccaagctgatgggctttggtgacact
gacgaggccaccttttatgctgtgacaccactgccctggtgtccccatttgacggcagtc
tgccccatacctgcagcaggcctggatgtgacacaaccctgtcaggactgcggatccctc
caggagaattgggtgtgcctgtcttgctatcaggtctgctgcggtcgttacatcaatgcc
catatgatccaacaccatgaagacttgggacatccactagttctcagcttcgtcgacctg
tctacctggtgttaccactgtcaggcatatgtccaccaccaggctctcctagatgtgaag
aatctcgcccaccaaaacaagttcggggaggacatgcctcgaccacactaa

DBGET integrated database retrieval system