KEGG   Loxodonta africana (African savanna elephant): 100677315
Entry
100677315         CDS       T04351                                 

Gene name
AVPR2
Definition
(RefSeq) vasopressin V2 receptor
  KO
K04228  arginine vasopressin receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100677315 (AVPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100677315 (AVPR2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100677315 (AVPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100677315 (AVPR2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Vasopressin
    100677315 (AVPR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Git3
Other DBs
NCBI-GeneID: 100677315
NCBI-ProteinID: XP_023396508
LinkDB
Position
Unknown
AA seq 444 aa
MAVPYSLGPIPPGPYGPGGWYLRANLYPCGFPGDLGAAALGARKGEAGSGRRDPVPRGTT
LCLGPLQSPFPNLALAFHPWPAGPGPLSRPSSPSNSSEEEPDPRDPLLARAELALLSTVF
VAVTLSNGLVLGALVRRGRRGHWAPMHIFIGHLCLADLAVALFQVLPQLAWDATDRFWGP
DVLCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWACSL
LLSLPQLFIFAQRDVGDGSGVLDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLI
FREIHASLVPGPSERARGRRSRHRPGGPSEGARVSAAMAKTVRMTLVIVIVYVLCWAPFF
LVQLWAAWDPEAPREGPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCSGRRRA
PPSLGPQDESCATASSSLAKERSF
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggctgtaccctactcactgggccccatccctcccgggccatacggccctggcggatgg
tacctgagggcaaatctatacccatgtggcttccctggagacctcggtgctgcagctctg
ggcgccaggaagggggaggcaggatcggggaggagggaccctgtcccgcgtggcaccacc
ttgtgcctgggtcccctgcagagccccttccctaacttggctctcgccttccacccctgg
ccagctgggcctgggcccctctctcggcccagctcccccagcaacagcagcgaggaggag
ccggaccctcgggacccactgctggcccgggctgagctggccctgctctcgacagttttt
gtggctgtgaccctgagcaatggcctggtgctgggcgctctggtgcggcgggggcggcgg
ggccactgggcgcccatgcacatcttcatcggtcacttgtgcctggctgacctggcagtg
gccttgttccaagtgctaccccaattggcgtgggatgccactgaccgcttctgggggcca
gacgtcttgtgccgggccgtcaaatacctgcagatggtgggcatgtatgcctcctcctac
atgatcctggccatgaccctggaccgacaccgtgccatctgccgccccatgctggcctac
cgccatggtggcggggctcgctggaaccggccggtactggttgcctgggcctgctcactc
ctcctcagcctgccacagctcttcatcttcgctcagcgcgacgtgggggacggcagtggc
gtcctcgactgctgggcccgttttgctgagccctggggcctccgtgcctatgtcacctgg
atcgccctaatggtgtttgtggctcctgccctgggcattgctgcctgccaggtgctcatc
ttccgggagattcatgccagcctggtgccagggccatcagagagggctagggggcggcgc
agcaggcaccggccaggcggccccagcgagggagcccgagtgtcggcagctatggccaag
accgtgagaatgacattggtgatcgtgatcgtgtatgtgctgtgctgggcccccttcttc
cttgtgcagctgtgggcagcgtgggacccagaggcccctcgggaagggccccccttcgtg
ctgctcatgctgctggccagcctcaacagctgcaccaacccctggatctacgcctccttc
agcagcagtgtctcctcggagcttcgcagcctgttgtgctgcagcggccggaggcgcgcc
cctcccagcctggggccccaggatgagtcctgtgctacggccagctcctccctggccaag
gagcggtccttctaa

DBGET integrated database retrieval system