KEGG   Loxodonta africana (African savanna elephant): 100677445Help
Entry
100677445         CDS       T04351                                 

Gene name
HKDC1
Definition
(RefSeq) putative hexokinase HKDC1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00051  Fructose and mannose metabolism
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav00520  Amino sugar and nucleotide sugar metabolism
lav00524  Neomycin, kanamycin and gentamicin biosynthesis
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav04066  HIF-1 signaling pathway
lav04910  Insulin signaling pathway
lav04930  Type II diabetes mellitus
lav04973  Carbohydrate digestion and absorption
lav05230  Central carbon metabolism in cancer
Module
lav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lav_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100677445 (HKDC1)
   00051 Fructose and mannose metabolism
    100677445 (HKDC1)
   00052 Galactose metabolism
    100677445 (HKDC1)
   00500 Starch and sucrose metabolism
    100677445 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100677445 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100677445 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100677445 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100677445 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100677445 (HKDC1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100677445 (HKDC1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100677445 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100677445 (HKDC1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100677445 (HKDC1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100677445 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100677445
NCBI-ProteinID: XP_003409354
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSEKGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGSELFEYVVDCLADFMKTKDLKHKKFPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRKHPDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTDFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMARDGLLFGGKKSSALLTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAAQHVCTIVSFRSANLCAAALAAILTRLRENKKLVRLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLK
REHLVSVQNKMRTELEYGLKKKTHPLATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQTSIDKGTLIEWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGHEDPNCEIGLIAGTGSNMCYMEEMRNIELVEENEGKMCINTEWGGFGDNGCIDDI
RTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRGILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRRENQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVSFLLSEDGSGKGA
ALITAVAKRLQQPRKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcggtacacttgatggcattttacttcaccaagctgaaggaggaccagatcaag
aaggtggacaggttcctgtatcacatgaggctgtctgatgagacccttctggatatcatg
gcacggttccaggccgagatggagaagggcttggggaaggacaccaaccccacagcctca
gtgaagatgctgcccaccttcgtcagggctattccagatggctccgaaaagggagagttt
ctttccctggatcttggaggatccaagtttcgagtattgaaggtgcaagtctctgaagag
gggaagcgaaatgtccagatggagagtcagttctacccaacgcccaatgaaattatccga
gggaacggctctgagctatttgaatacgtagttgattgtctggccgatttcatgaagact
aaagatttgaagcataagaaatttccccttggcctaacgttttcgttcccctgcaggcag
actaaattggaagagggagtcctgctttcctggaccaagaagtttaaggcgcgaggagtt
caggacacagacgtagtgagtcgtctgaccaaagccatgagaaaacacccggacatggat
gtggacatcctggccttggtcaatgacacggtggggaccatgatgacttgcgcctatgat
gatccctactgtgaagtcggcgtcatcattggaactggcaccaacgcctgctacatggag
gacatgagcaacattgacctggtggaaggtgacgagggaaggatgtgcatcaacacggag
tggggggcctttggggacgatggggctttagaagacatccgcacggattttgacagggag
ctggaccttggctctctcaacccagggaagcaactgtttgagaagatgatcagtggcctg
tacctgggggaactcgtcaggctcatcttgctgaagatggccagggatggcctcctgttt
ggtggcaagaaatcttcagctctccttactaagggcaagattgagacacgacacgtggct
gccatggagaagtataaagaaggccttgccaacaccagagagatcctgacagacctgggc
ctggagccgtcagaggctgactgcattgcggcccagcacgtgtgcaccattgtctccttc
cgctcagccaatctctgtgcagcggccctggcagccatcctgacacgcctccgggagaac
aagaagctggtgcggctgcggaccacggtgggcatggacggtaccctctacaagatacac
ccccagtacccgaaacgcctgcacaaggtggtgaggaaactggtgccaaactgtgacgtc
cgcttcctcctgtcagagagcggcagcaccaagggggccgccatggtgacggccgtggcc
tcccgcgttcaggcccagcggaagcagatcgacaaggtgctggctttgttccagctgaag
cgcgagcacctggtgagcgtgcagaacaagatgaggactgagctcgagtatgggctgaag
aagaagacgcacccactggccacggtcaagatgctgcccacctatgtctgcgggatgccg
gatggcacagagaaagggaaatttctggccctggatctgggtggaaccaacttccgtgtt
ctcctggtgaagatcagaagcgggcgaaggtcggtgcggatgtacaacaagatcttcgcc
atccccctggagatcatgcagggcacaggcgaggagctgtttgaccacattgtgcagtgc
atcgctgacttcctggactacatgggcctgaagggagcccagcttcctttgggcttcacc
ttctcctttccctgcagacagacaagcattgacaagggaacactcatagagtggaccaaa
ggcttcaaggccaccgactgtgaaggggaagatgtggtggacatgctcagggaagccatc
aagaggagaaatgaatttgacctggacatagttgcagtggtgaatgacacggtggggacc
atgatgacctgtggccatgaagaccccaattgtgagattggcctaattgcaggaacaggc
agcaacatgtgctacatggaggagatgaggaacatcgaactggtggaagagaatgaaggg
aagatgtgcatcaacacagagtgggggggatttggagataatggctgcatagatgatatc
cggacccaatatgacaaggaggtggatgaggggtccttgaatcctggaaaacagaggtat
gagaaaatgacaagtgggatgtacctgggtgagatagtgcggcagatcctgatcgacctg
accaagcagggtcttctcttccgcgggcagatttcagagcgtctccggactaggggcatc
tttgaaaccaagttcctgtcccagatcgaaagtgaccggctggccctcctccaggtcagg
gggatcctgcagcagctcggcctggacagcacatgcgaggacagcattgtggtgaaggag
gtgtgtggagccgtgtcccggcgagcagcccagctctgtggtgctggcctggctgccatc
gtggagaaaaggagggaaaaccaggggcttgagcacctgaggatcactgtgggcgtggat
ggcaccctgtacaagctgcaccctcacttttctcggatattgcaggaaaccgtgaaagag
cttgcgcctcgatgtgacgtgtcgttcttgttgtcagaagatggcagtgggaagggagca
gctctcattactgctgtggccaagcggttacagcagccacggaaggagaactag

DBGET integrated database retrieval system