KEGG   Loxodonta africana (African savanna elephant): 100677447
Entry
100677447         CDS       T04351                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04144  Endocytosis
lav04150  mTOR signaling pathway
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04350  TGF-beta signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04611  Platelet activation
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04660  T cell receptor signaling pathway
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04972  Pancreatic secretion
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100677447 (RHOA)
   04015 Rap1 signaling pathway
    100677447 (RHOA)
   04310 Wnt signaling pathway
    100677447 (RHOA)
   04350 TGF-beta signaling pathway
    100677447 (RHOA)
   04072 Phospholipase D signaling pathway
    100677447 (RHOA)
   04071 Sphingolipid signaling pathway
    100677447 (RHOA)
   04024 cAMP signaling pathway
    100677447 (RHOA)
   04022 cGMP-PKG signaling pathway
    100677447 (RHOA)
   04150 mTOR signaling pathway
    100677447 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100677447 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100677447 (RHOA)
   04520 Adherens junction
    100677447 (RHOA)
   04530 Tight junction
    100677447 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100677447 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100677447 (RHOA)
   04621 NOD-like receptor signaling pathway
    100677447 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100677447 (RHOA)
   04660 T cell receptor signaling pathway
    100677447 (RHOA)
   04670 Leukocyte transendothelial migration
    100677447 (RHOA)
   04062 Chemokine signaling pathway
    100677447 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100677447 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100677447 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100677447 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100677447 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100677447 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100677447 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677447 (RHOA)
   05206 MicroRNAs in cancer
    100677447 (RHOA)
   05205 Proteoglycans in cancer
    100677447 (RHOA)
   05203 Viral carcinogenesis
    100677447 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100677447 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100677447 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100677447 (RHOA)
   05135 Yersinia infection
    100677447 (RHOA)
   05133 Pertussis
    100677447 (RHOA)
   05152 Tuberculosis
    100677447 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100677447 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100677447 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100677447 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100677447 (RHOA)
   04031 GTP-binding proteins [BR:lav04031]
    100677447 (RHOA)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100677447 (RHOA)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100677447 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100677447 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100677447 (RHOA)
  Exosomal proteins of bladder cancer cells
   100677447 (RHOA)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100677447 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100677447
NCBI-ProteinID: XP_003409708
UniProt: G3T492
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggcaagacctgt
ttgctcatagtcttcagcaaggatcagttccccgaggtgtatgtgcccacagtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca
gcggggcaagaagactatgatcgtctgaggcccctctcctacccggacactgatgttata
ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggacc
ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa
cctgaagaaggcagggatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system