KEGG   Loxodonta africana (African savanna elephant): 100677531
Entry
100677531         CDS       T04351                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100677531 (PMAIP1)
   04215 Apoptosis - multiple species
    100677531 (PMAIP1)
   04115 p53 signaling pathway
    100677531 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677531 (PMAIP1)
   05203 Viral carcinogenesis
    100677531 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100677531 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100677531 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1 PXT1
Other DBs
NCBI-GeneID: 100677531
NCBI-ProteinID: XP_003406322
LinkDB
Position
Unknown
AA seq 55 aa
MPGKKARKSAQPGPAGTPAERDVVECAIQLRRIGDKINFRQKLLNVICKLFCSGT
NT seq 168 nt   +upstreamnt  +downstreamnt
atgccggggaagaaggcacgcaagagcgcgcagcccggccctgccgggaccccggcagag
cgcgatgttgtcgagtgtgctattcaactcaggagaattggagacaaaattaatttccgg
cagaaacttctgaatgtgatatgcaagctcttctgctcaggcacctga

DBGET integrated database retrieval system