KEGG   Loxodonta africana (African savanna elephant): 104845494
Entry
104845494         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104845494
   05414 Dilated cardiomyopathy
    104845494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    104845494
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    104845494
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    104845494
   04147 Exosome [BR:lav04147]
    104845494
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104845494
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104845494
Membrane trafficking [BR:lav04131]
 Others
  Actin-binding proteins
   Others
    104845494
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     104845494
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104845494
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Titin_Z Ig_6 Pkinase C1-set PK_Tyr_Ser-Thr Adeno_E3_CR1 PPAK THB Ig_4
Other DBs
NCBI-GeneID: 104845494
NCBI-ProteinID: XP_023398816
LinkDB
Position
Unknown
AA seq 34191 aa
MATEAPTFKQPLQSVVVLEGSTATFEAHVSGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VCLQVKVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIISTAQISETRQTRIEKKIEAHFDARSMATVEMV
IDGAAGQQLPHKAPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSPIRSIRSPLLVRKSQTPTMPTGPEVPPPWKQEGYVASSETQMRE
TTMTSATQIRTEERWEGRYGIQEQVTISGAAGAAASVSASAAFAAEAVATGAKEVKQETD
KSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQIRKEAEKTAVTKVVV
AADKAREQELKSRTREVITTKQEQMHVTHEQIRKETEKAFVPKVVISTTKAKEQETRVTG
EITTKQEQKEVTQETIKQEAETTAAAMVVVAVAKPKQLETVLGAQEEISIKQEQKHITHE
KIMKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVQITQEKMRKEAEKIALSTI
AVATAKAKEQETILRTREGMATREEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPRE
PGHLEESYAQKTTLEYGYKERVSAAKVAEHPQRPASEPPVVPKAVKPGVVRPPPETHITT
TDQMGMHISSQIKKTTDITTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGTAI
ATLQKELSATPSAQKVTKSVKPPTVKPSETKVRAEPTPSPQFPFADMPDTYKSQADIEVK
KKVGVSITGATVREERFEVLHEREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGES
VTLECHISGYPSPAVTWYREDYQIESSIDFQITFHSGIARLMIREAFAEDSGRFTCSAVN
EAGTVSTSCYLAVQVSEEFEKETTAVAEKFTTEEKRFVESRDVVMTDTSITEEQAGPGEP
AAPFFVTKPVVQKLVEGGSVVFECQVDGNPKPHVYWKKSGVPLTTGYRYKVSYDKQTGEC
KLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYESLMKSQHEMLYQTQMTAFVQE
PKVGETAPGFGYADFEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISSFEERLIKEIE
YRIIKTTLEELLEEDGEEKMSVDISESEAVEAGFDLRIKNYRILEGMGVTFHCKMSGYPL
PKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKL
YVEPAAPLGAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPARMSPARMSPGRRLD
ETDESQLERLYKPVFVLKPTSFKCLEGQTARFDLKVVGRPMPETLWFHDGQQIVNDYTHK
IVIKEDGTQSLIIVPATPSDSGEWTVRMAHEGALTGVXTDQKEKQKPDIVXVPEPVRVLE
GETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTA
ENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHIHEPGKLQFEVQKVDRPVDTTETK
EIVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKT
KEELLHWTKELTEEEKKALMEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSD
AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAI
NIAGETSSHAFLLVQAKQSITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEV
HSGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLAEDENVKTTAKLIVEGAVVEFVKELQ
DIEVPESFSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQG
EYSFVIDGKKTSCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQE
VQSSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVLTPLKDV
NVIEGTKAILECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHASDEGP
YKLMVGRVETSCNLSVEKIKIIRGLRDRTCTETQNVVFEVELSHSGIDVLWNFKDKGNQR
LTLYFSCSKGGAISKPLTDQTVAESQEAVFECEVANPDSEGEWLKDGKHLPLSNNIKSES
DGHKRRLIIVATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVE
LTHPNVKGVQWIKNGVMLQSNDKYDISIKGTVYLLRIKNCAVVDESVYGFRLGRLGASAR
LHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKNVEIKPSGKHRLVSERKVH
KLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKAASFECEVSHFN
VPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPI
MITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRN
VHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAVFECEVSEPDITVQ
WMKDGQELQIVDRIKIQKEKYVHRLLIPSTRMSDAGRYTVVAGGNMSTANLFVEGRDVRI
RSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQIQERHQYVVERRIHRMFISE
TRHSDAGEYTFVAGRNRSSVTLYVNAPEPPQILQELQPITVQSGKPARFCAVISGRPQPK
IFWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE
VPEVLSPDQEMPVYPPAIITPLQDTITSEGQPARFQCRVSGTDLKVSWYSKDKQIKPSRF
FRMTQFEDTYQLEIAEAFPEDEGIYTFVASNMVGQVSSTANLRLEAPESILQERMGQQIE
VEMKEFSNSLLSAEEEELQIYSSDLQLSNTNETLELWSEPPVHSTKFGSKKAGSVPAFIK
EVSNAEISIGDVAKLSVTVTGIPKPRVQWFFNGVMLTPSADYKFVFDCNDHSLIILFTKF
EDEGEYTCIASNEYGKAVCSAYLKINSKREGHEETGTKLAVEKPVEKLKGPCPPYFLKKL
KPIQCAQGLPAIFEYMVLGEPGPTISWFKENKQLCTNIYYTIIHNPDGSGTFIVNDPQRE
DSGLYVCKAENVWGESTCAAELLVPLEGTDMTDSPCKVKSMPEATVEEGISQIDFPQKSS
LKDLSIETFDSEQETTTFVKDTILKAALIAEEKQQLSYEHIVKTSELSSQVTLETQQLQS
TVMLGQDMPTPESTSELSIDGTILIHSLKEPSPSLQLQTVQSQETLPKEDMLMLEEPASQ
VILSDTEKIFPSAMSTEEISSLTAEPLQTLLAEPERSYPESSAGPQTDSCFSTVAEEVLL
PKEKTVSAVDNEQRATLQKQEAHSAVILTQGLAEGCMEIFKGPDVAISEVNYEPQVPSEH
TCTVEEGLMLESADQLESAGQDFAAKLEEGKALSFPLALEEKQVLLKEEHSANLAMTLSQ
TIECKREPMTIREVQEVQGSDTLSKENLLADIPDEQRLNLKTQIRRALRAAVASEQPSLF
SEWLRDIEKVEVKAVSLTQEPKRILCTYLITSVASVTQELTITIEGIDPQMANLKTELKD
ALCSIICEEQNILIAEDPRIQKGAKTRSQEETVASSDSQKVEVITEPEAESKYLVSAEEV
SYLHVNTQVKFVATALSDGVVAAALSDEKQDDILKLSQAEEKSSKSCTEEVDRAKVEETE
GSLVTEDCPVIYTPLEDTIAEEGDAIYLTSSITNAKEVNWYFESKLVPSDGKFKCLQDQN
TYTLVIDKVNTEEHQGEYACEALNDNGKTTTSAKLTVVKRAAPVIKKRIEPLEVALGHLA
KFTCEIQGAPKVRFQWFKGGREIYESDKCSIRSANYVSSLEILRTQVVDCGEYTCKASNE
YGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKAAKFLCTVVGTPTIETIWQKDGAALSP
SPNRRISHAENKHILELSNLTTQDRGVYSCKASNKFGADSCQAELIVIDKPRFIKELEPV
QSAINKKIRLECQVDEDRKVTVTWNKDGQKLPPGKDYKIYFEDKIASLEIPLAKLKDSGT
YVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFK
NNKELNESSTVRMSFAKSEAILDIMDVKVEDSGNYSCEAVNDVGSDSCSTEIVIKEPPSF
IKTLEPADVVRGTNALLQCEISGTGPFEISWFKDKKQIRSSKKYRLFSQKSVVSLEIFSF
NSADVGEYECVVANEVGKCGCSATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPI
YVTWMKEQEAIKEDGKIKMSFSSGVAVLIIPDVQISFAGKYTCLAENEAGSQTSVGELIV
KEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRVSFKNNVAQ
LKFYSAELHDSGQYTFEISNEVGTSSCETTFTVLDRDIAPFFTKPLRNVDTIVSSTCRLD
CKIAGSLPMRVSWFKDGKEIASSDKYRIAFVEGTASLEISRVDMNDAGNFTCRATNSVGS
KDSSGALIVQEPPSFVTKPESKDVLPGSAVCLKSTFQGSTPLTIRWFKGDKELVSGGNCY
IYKEALESSLELYSVKTSDSGTYTCKVSNVAGSTESSANLFVKGPAMFVEKLEPSQLLKK
GDTTQLTCTVTGTPPIKITWFVNDREIKESRKHKISFVESTAVLRLTDVAIEDSGEYMCE
AQNEAGSDHCSGIIIVKEPPYFTKEFKAIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTL
RSGRKYKTFIQDQLVSLQILKFVAADAGEYQCRVTSEVGSSTCSARVTLREPPAFVKKIE
STSSLRGGTAAFQATLKGSVPITVTWLKDNEEITEDDNIRMTFENNVASLYLNGIEVKHD
GKYVCQAKNDAGIQRCSALLSVKEPATIIDEAVSIDVTQGDPATLQVKFSGTKEITAKWF
KDGQELTLGHKYKISVTDTVSVLKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLDLII
PPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLE
ISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNMRVQLKALVGG
TAPMTIKWFKDNKELHSGAARSVWKDDTSTVLELFSAKAADTGTYICQLSNDVGIATSKA
TLFVKEPPQFIKKPSPVVVLRNGQSTTFECQITGTPEIQVSWYLDGNEITAIEKHGISFV
DGLATFHISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKDSDVE
LECEVTGTSPFEVTWLKNNKEIRSSKKYTLTDRVSVFNLHITRCDPSDTGDYQCIVSNEG
GSCSCSTKVSLKEPPSFTKRIENVTAVLKSSATFQGTVAGSPPILITWLKDDQILDEDDN
VHMSFVNNVAALQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIIEKAKSVDVT
EKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSLENNVASFRIQSVMKQDSGQYTF
KVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKD
GKEISTSAKYRLVCHENTVSLDINNLELEDTANYTCRVSNVAGDDACSGILTVKEPPSFL
VKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELTSGPKCFIGLEGSTSFLNLYSVD
ASKTGQYTCQVTNDVGSDSCTTVLLVTEPPKFVKKLEASKIVKAGDSARLECKIAGSPEI
RVMWYRNEHELPPSEKYRMTFIDSVAVIQMNNLGTEDSGDFICEAQNPAGSISCSTKVIV
KEPPIFSSIPPVVETLKNTEVSLECELLGTPPFEVVWYKDKRQLRSSKKYKIASKNFHAS
IHILNVETSDIGEYHCKAQNEVGSDTCICTVNLKEPPRFVSKLSSLTVVAGEPAELQASI
EGAQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPADAGKYICQVKNDGGMRE
NMATLTVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFS
FFNKVSSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVIDISDRAVPPSFTRRLKNIGGVL
GTSCILECKVAGSSPISIAWFHEKTKIVSGAKYQTIFSDNVCTLQLNSLDSSDMGSYTCV
AANVAGSDECRAVLTVQEPPSFVKEPEPSEVLPGKNVTFTSVIRGTPPFKVGWFRGAREL
VKGDKCNIYFEDTVAELELFNVDVSQSGEYTCVVSNDAGHTFCTTRLFVKEPAAFVKKLS
DQSVEPGKSIILESTYTGTLPISVTWKKNGFNITQSEKCNIVTTEKTCILEILNSTKRDT
GQYSCEIENEAGRDVCEALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWY
KGDTKLRPTPEYRTYFTNNMATLVFNKVNINDSGEYTCKAENSIGTASSKTIFRIQERQL
PPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYKDGVLLRDDENLQTSFVDNVATLK
ILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECH
VTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDM
CSAQLSVKEPPKFVKKLEASKVAKQGEPVQLECKISGSPEIKVLWFRNDSELHESWKYNM
SFINSVALLTINEASTEDSGDYICEAHNGVGDASCSTALTVKAPPVFSQKPSPVGALKDS
DVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILRFEASDVGEYYCKAA
NEVGSDTCVCTVKFKEPPRFVKKLSDTSTLVGDAVELQAVVEGFQPISVVWLKNGDVIRE
SENTRISFMDNIATLQLGSPEASNSGKYVCQIKNDAGMRECSAVLTVLEPARITEKPEPM
TVTTGNPFALECVVTGTPELSARWFKDGREISADSKHHITFVNKVASLKIPSAEMSDKGL
YSFEVKNSVGKSNCTVSVHVSDRVVPPSFIRKLKDTNAILGASVVLECRVSGSAPISVGW
FQDGNEIVSGPKCHSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSEECSAVLTVQEPP
SFEQTPDSVEVLPGTSLIFTSVFRGTPPFQVKWFKGSRELVSGESCTISLEDFVTELELL
EVEPLQSGDYSCLVTNDAGSASCTTHLFVKGLFFSLIHVLLFHFSQSSLEKGFLTSCFLL
IEPATFVKRLADFSVESGSPIVLEATYSGTPPISVSWMKNEFPLSQSQNCSITMTEKSTI
LEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPTTLQCKV
DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENIVGAVAS
SAVLVIKERKLPPSFARKLKDVQEILGFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQ
TSFVRNVATLQILQTDQSHVGQYNCSASNSFGTASSSAKLILLEHEVPPFFDLKPVSVDL
ALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYT
CYASNVAGKDSCYAQLGVQEPPRFIKKLEPSRIVKQDEYTRYECKIGGSPEIKVLWYKEE
TELQESSKVRMSFVDSVAVLEMYNLSVEDSGDYTCEAHNTAGSASSSTSLKVKEPPIFSK
KPHPIETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILHVDA
ADIGEYQCKAINDVGTDTCIGSITLRAPPRFLKTLSDISTIVDKEVQLQTTIEGAEPISV
TWFKDKGEIVRESDNIWISYSENIATLQFSRAEPGNAGKYTCQIRNDAGMQECSATLSIL
EPAAIVEKPESISVTSGDTCTLECIVTGTPELSTKWFKDGKELMSDSKYKISFFNKVSGL
KIISVTPNDSGVYSFEVQNPVGKDSCTASVQVSDRIVPPAFTRILKETSGLSGSSVVMEC
KVYGSPPISVSWFHEGNEISSGRKYQATLTDNTCALTVNVLEESDAGYYTCVATNVAGSD
ECGASLTVREPPSFVQKPDSMDVLTGTNVTFTSIIKGTPPFSVSWFKGSSELVPGDRCNV
SLEESVAELELFDVDTSLSGEYTCIVSNEAGKASCTAHLYVKAPAKFVKRLNDYSIEKGK
PLILEGTYTGTPPVSVTWKKNGINIIPSQRCTITTTEKSAILEIPSTMVEDAGQYNCYIE
NASGKDSCSAQILILEPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIAVSWYKGDTKLRP
TDTYKMHFRNNVATLVFNQVDSNDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQL
RDVQETVGLPVVFECAIRGSEPISVSWYKDGRPLKDGPNIQISFLDNVATLNIFKTDRSL
AGQYSCTATNPIGSASSSARLILTEGKNPPFFDIPLAPVDALAGESADFECHVTGTQPIK
VIWAKDNREIRSGGNYQISYLENSAHLTILKVDKGDSGQYSCYAVNEVGKDSCSAQLNIK
ERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYRNNVEIHPTSNCEITFKNN
ALLLQVRKAGMADAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTSVTASEGEFV
QLTCHVQGSEPIRIQWLKAGREIKPSDKCIFSFANRTAVLELKDVAKADSGDYVCKASNV
AGSDTSKAKVAIKDKPAAVPVAKKAAIDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIP
NVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQ
VDERKKQEKIEGDLRAMLKKTPVLKKGPGEEEEIDILELLKNVDPKEYEKYARMYGITDF
RGLLQAFELLKQSQGEETHRLEIEEIEKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIE
NQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSDKFEILIDGDRHTLRVKNCQLKD
QGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRI
LKPQGRYKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEAEPIQFTRRIQNI
VVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVY
SVIARLEPRGEARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVVP
PIPLLLPTPEEKKPPAKRVEVSKKAVKKDTKKVVAKPKEEAPPKEVVKKPLPPTALIPAK
APEIIDVSSKAEEVKIMTISRKKEIQKEKGAVYEKKEAVYEEKKVFIESFEEPYEELEVE
PYTEPTEEPYYEEPEEDYEETKVEARKEFHEEWEEDFEEGQEYYERAEGYDEGEEDWEEA
YREREVIQVQKEAYEEAHEREIPAKVPEETEALPPKVVKKPVVEKIEKTSRRMEEEKVQV
TKVPQVSKKIVPQKPSRIPVQEEVIEVKVPAVQAKKMVVSKEEMFFAAYTEEEVSVTVPE
VQRKTVTEERVHVAVSKKIEPPPKVPEPPKKPVPGEVVPVPIPKKAEPPAAKVPEVPKKP
VPEEKKLVPEPKKEVPAPAKVPEVPKKPVPEEKVPVPVAKKKEAPPAKVPEVEKRVVTEE
RITVVTQREESPPPAVPEIPKKKVPEERRLIPQKEEEAPPPKVPALRKKPVPEEKAPVPV
PVTKKAPPPRAEVSKKIVAEEKRFVAEEKQSFAVPQSVEVMRHEEEEWSYEEEERISVSV
YREEEREEEEEKVEVTEYEVMEEPEEYVVEEKLHLIAKRVEAEPAEVPEEPRKIVPKPKV
PAKKEEPPPAEVPEAPKKIVPEKKIPAAVPKKEKVPPAKVPEEPKKPVPEKRAPPKAVTV
EEPPAARVTERHKQISQDEKAHVAVTKKEEAPRARVPEEPKRAVPEEKVPKLKPKKEAEP
PAKVAEIRKRAVREEKVSIEVPKREPDRAKEAITVTEEKKWSYAQEEETISVQREEEYEE
YEEYDYKEFEEYEPTEEYDQYEEYEERELERYEEHEEYVTEPEKPIPVKPVQEEPVPIKP
KAPPAKVLKKAVPEEKVPVPITKKIKPPPPKVPEEPKKLVEEKIHISVTKREKEQVTEPA
AKVPMKPKRVVPEEKVPVPKKEVAVPVPKKEVAAPVRVPEVPKRPEPEELALAEEGVTEV
EEYLVEEEEYIHEEEYVHEEEYVHEEEYIHEEEYIREEEELVTEEEVVPVIPVKVPEVPK
KPVPEEKKPVPVPVPKKREAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVA
EEKVPIPVPKKVEAPPAKVPEVPKKPVPEKKVPVPAPKKVEAPPTKVPEVPKKPIPEEKK
PTPVAKKVEAPPAKVPKKLEPVPVPVALLREEELPFEEEIAPEEEVPSEEEEVPPEEEEV
PPEEEEVPPEEEEVPPEEEEVPPEEEEVPPEEEEFVPEEEVVPEEEEVLPEIKPKVPVPA
PVPKKPVPEKKVPVLTPKKVEPPPPAKVPEVKKKVPEKKVAVPKKEEAPPAAVPVVPKKP
EPEKKVPPPGLKKAVPPPAKVPEVPMRVEERRVVLPKEEEVAPVEVFEEPEEPILEEEII
EEPPSIEEVETVVPPRVPEVVKKPEPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVHKKE
APPAKVPEVQKKVPEKKIPEKKVPEKKIPEKKVPVPKREAVLPTKERTVFEEKISVAFHK
EEVVKERLEVEARVEEFLGEEEFHEVEEHFEKEEFHEVEEFIKVEEHRVEEVHEAEEVHR
EIKVLEVEEVEVYEEPKAPPQGPEISEKIVPPKKPPIKVVPRKEPPAKVPEVPKKTVIEE
KVRVPEEPKIPPVKVPEALPEAPKEVVPEKKVPVAPPKKPEAPPAKVPEAPKEVVPEKKV
PVAPPKKPEAPPAEVPEVLKAAVPEKKVPEVIPPKPGSPPPAVPEAPKEVVPEKKVPMAP
PKKPEAPPIKVPEAPKEVVPEKKVPVAPPKKPEAPPAKVPEVPKVTVPEKKVPEVIPPKP
ESPPPAVYEEPEEILVEEPPAEVVEEPEPPAPAKVIEPPKKPVPEKKPPAVIAKKPEPPP
VKVPEAPKKVVPEKKVPPVAPQKAEVPPAKVPEVPKEVVPEKKVAVPKKPEAPPAKVPEV
PKKPVLEEKPAVPVPKKVEPPPPEVYEEPEEIVPEEKEPEEIVPEEKEPEEIVPEEKEPE
EIVPEEKEPIPVAEEEEPEAPPPAAPEEPKIVPEKKVPVIKKPEAPPPKEPEPEKKVIEK
PKLKPRPPAPPPAPPKEDVKEKIFQLKAVSKKKVPEKPEVPEKVELKPLKAPGAEKKVRK
LLPEPKPQPKEEVVLKSVLRKKPEEEEEPKKVEKVEKVKKPEVPEPPPKAVEEVEVPPAT
VTKRERKVPEPTKVPEIKPAIPLPAPEPKPKPQPEVKIIKPPPVEPAPTPIAAPVTVPVV
GKKAEAKAPKEEAAKPKGPIKAVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAV
PLKFVKEIQDIVLKEAESIGSSAIFECLVSPSTAVTSWMKDGSNIRESPKHRFIADGKDR
KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEIPVRFVKTLEEEVTVVKGQPLYLS
CELNKERDVVWRKDGKIVVEKPGKIVPGVIGLLRALTINDADDFDAGTYTVTVENANNLE
CSSCVNVVEVLRDWLVKPIRDQHVKPKATAVFTCDLAKETPNIKWFKGYDEIPTEPNDKT
EILRDGNHLYLKIKNATPEDVAEYAIEIEGKRYSAKLTLGEREVQLLKPIEDVTIYEKES
ASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNA
ITTAILTVKEIELDFAVPLRDVTVPEKRQARFECVLTREANVIWSKGPDIIKSSDKFDII
SDGKKHILVINNSQFDDEGVYTAEVEGKKTSARLFVTGVRLKFMSPLEDQTVKEGQTATF
VCELSHEKMHVVWFKNDVKLHTSRTVLMSSEGKTHKLEMREVTLDDISQIRAQVKDLSST
AQLNVLEADPYFTLKLHDKTGVEKDEIILKCAVSKDVPVKWFKDGEEIVPSPKHSIKTDG
LHRILKIKKAELKDKGEYVCDCGTDTTKANVTVEARLIKVEKPLRGVELFVGETARFEIE
LSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHILILHNCQLNMTGEVSFQAANAKSAASL
KVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEIIGDDRIELIKDGTK
HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLTDVTAKERESAVFTVELS
HDNIRVKWFKNDQRLHTTRRISMQDEGKTHSITFKDLSIDDTSQIRVEAMGLSSEAKLTV
LEGDPYFTGKLQDYTGVEKDEVILQCEISKPDAPVKWFKDGKEIEPSKNAVIKADGKKRM
LILKKALKSDIGQYTCDCGTDQTSGKLGIEDREIKLVRPLCSVEVIETETARFETEISEE
DIHANWKLKGEALLQTPECEIKEEGKTHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKP
RAIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVARSDGRVHTLT
LRDVKLEDAGEVQLRAKDFKTQANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENA
KVKWFKNGTEILKSKKYEIVTDGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPH
VEFLRPLTDLQVKEKEMARFECEISRENAKVQWFRDGAEIKKGKKYDIISKGAVRILVIN
KCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAGV
IWYKGDEEIIETGRYEIVTEGRKRILIIQNAHLEDAGSYNCRLPSSRTDGKVKVHELAAE
FISKPQNLEILEGEKAEFTCTISKESFEVQWKRDDQTLESGDKYDIIADGKKRILVVKDA
TLQDMGAYVVMVGAARAAAHLTVIEKLRIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWF
RNEEAIFDSSKYIILQKDLVYTLRIRNARLDDQANYSVSLTNHRGENVKSAANLIVEEED
LRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWMKNGEEVPLDNRVLYRIDKYKHSLIIK
DCGFPDEGEYTVIAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANV
KWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVE
IIRPPQDILEAPGADVVFSAELNKDKVEVQWLRNNMIIVQGDKHQMMSEGKIHRLQICDI
KPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEW
FKDNEALSSKTVDTTAEQTSFRILKAKKGDRGRYKIVLQNKHGKAEGFINLRVIDVPGPV
RNLEVTEALDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCDFTVTGL
QKGGIEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDVNRFGVSLTWEP
PEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGV
GKPSAATPFIKVTDPVERPSPPVNLNASDQTQSSVQLTWEPPLKDGGSPILGYIIERCEE
GKDNWIRCNTKLVPKLTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDSFVEP
TMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWSFGDKVLEAGDRVKMKTISAYAELV
ISPSERPDKGIYTLKLENPVKAISGEIDVNVIARPSAPKELKYGEVTRDSVHLTWEPPDD
DGGSPLTGYLVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYVFKVCARNKCGPGEPA
YVDEPVNMSAPATVPDPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDK
WVACGEPVADTKMEVTGLEEGKWYSYRVKALNRQGASKPSKPTDEIQAVDTQEAPEIFLD
VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADTLLKQDKRITIENVPKKSTVTIVDS
KRSDTGTYIIEAVNVCGRATATVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGS
KVTNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYLFRVAAENMYGVGEPVQASP
ITAKFPFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWLERLDPDTDKWVRCN
KMPIKDTTFRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPIVK
DVGKTSLTLKWTKPEHDGGAKIESYVIEMLKTGTEDWVRVAEGVPTTEHKLPGLMEGQEY
SFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGS
PITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEIED
SVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKA
GKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGIGHPSEPTEILSIEDPTGPPSPPLDLHV
TDAGRKHIAIAWKPPEKDGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPD
KEYVLRVRAVNAVGVSEPSEISENVVAKDPDCRPTIDLETHDIVVIEGEKLSIPVPFRAV
PVPTVSWHKDGKDVKASDRLTMKSDHISAHLEVPKSVRADAGVYTITLENKLGSATASIN
VKVIGLPGPCKDIKASEVTKTSCKLTWEPPEYDGGTPILHYVLERREAGRRTYIPVMSGE
NKLSWTVKDLIPNSEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA
KAMTITWKPPLYDGGSKIMGYIIEKIAKGEDKWKRCNEHLVPVLTYTAKGLEEGKEYQFR
VRAENAAGIGEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDATVSGSPYPTITW
IKDENVIIPEEIKKRPAPLARRRRGEVQEEEPFFLPLTERLSIDNSKQGESQLRVRDSLR
PDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEI
INYTLEKKDKTKPDSEWIIITSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKP
LTAKDPFEPPDAPDKPIVEDVTSNSMLVTWNEPKDNGSPILGYWLEKREVNSTHWSRVNR
NLLNSLKTNVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPVPRVTDT
SSTTIELEWEPPAFNGGSEIIGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKQIREGADYK
LRVSAVNAAGEGPPGETGPVTVAEPQEPPSVELDVSVKAGIQIMAGKTLRIPAVVTGRPV
PTKVWTIEEGELDKDRVVIENVGTKSDLVIKNALRKDHGRYVITATNSCGSKSAAARVEV
FDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSELTGFIIERKDAKMHTWRQPIETERSK
CDITGLLEGEEYMFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITL
DWKEPRNDGGSPIQGYIIEKRRHDRPDFERVNQRLCPTTSFLVDNLDEHQMYEFRVKAVN
AIGESEPSLPLNVVIQDDEAPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWA
KNETVIEKPTEALQITKEEVSRSEAKTELSIPKAVRGDKGTYTITAANRLGSVFRNVHVE
VYDRPSPPRNLAVTDIKADSCYLTWDAPLDNGGSEITHYVIDKRDASRKKVEWEEVTNTA
VDRRYGVWKLIPNGQYEFRVRAVNKYGTSDECKSDKTVIQDPYRLPGPPGKPKVLERTKG
SMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKLGLKGVEFNVPRLIEGVK
YQFRAMAINAAGIGPPSEPSDPALASDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGG
SPIKGYIVEMQEEGTTDWKKVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPS
DTTGEIPATDIQEEPEVFIDIGAQDSLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKA
VKDGIHDIPEDAQLETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPG
PPKDLKVSDITRSSCKLSWKVPDDDGGDRIKGYVIEKRTIDGKAWTKVNPNCGSTTFVVP
DLIAEQQYFFRVRAENRFGIGAPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWK
PPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNKRDVEELQFTVEDLIEGGEYEFRVKA
VNAAGVSKPSATVGPVIVKDQTCPPSIDLKEFMEVEEGTDVSIVAKIKGVPFPTLTWFKA
PPKKPDDKQPVIYDTHVNKLVVDDTCTLVIPQSRRNDTGLYTITAVNNLGTASKEMRLNV
LGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKE
CMYTIPKLLEGHEYVFRIMAENKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSM
TVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQF
RVYAINAAGVGPASLPSDPVRARDPIAPPGPPFPKVTDWTKSSVDLEWTPPLKDGGSKVT
GYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAINIAGIGEPGEATDII
EMKDRIVLPDVQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSKNESALPQEATIET
TAISSSMVIKNCERSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGIPFLAHNLTNDSC
KLTWFTPEDDGGSPITNYVIEKREADRRAWTPVTCTVTRQNATVQGLIQGKAYFFRIAAE
NSIGMGPFVETSDELIIRDPITVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVL
ESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKD
ELAPPTLDLDFRDKLIIRVGESFALKGRYSGKPKPKVTWFKDEADVLEDDRTHIKTTPTT
IALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVAVVDRPGPPVGPVIFDEVTKDHMVISW
KPPLDDGGSEITNYIIEKKEVGKDVWMPVTSASAKPTCKVSKLLEGKDYIFRIHAENLYG
ISDPLVSDAMKAKDRFRVPDAPEQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETM
SKRWARVTKEPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPIFAKDPIAKP
SPPINPEAVDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETK
YKVTGLRDGQTYKFRVIAVNKAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVG
DTLRLSAIIKGVPFPKVTWKKEDREAPTKATIDVTPVGSKLEIRNAAHEDGGIYSLTVEN
PAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERRDVAS
AQWSPLSTTSKKKSHLAKHLNEGNQYLFRVAAENQYGRGPFVETLKPIKALDPLHPPGPP
KNLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGAQDWTKFKTVTNLECVVTGLQ
QGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAI
IRGVPIPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCIRRDTGEYQITVSNAAGSKT
VAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTKKDTWGV
VSSGSSKTKLKIPHLQKGSEYVFRVKAENKMGVGPPLDSTPTVAKHRFSPPSPPGKPVVT
DITENAATVSWTLPKSDGGSPITGYYVERREVTGKWVRVNKTPITDLKFGVTGLYEGNTY
EFRVFAENLAGLSNPSPSSDPLKACRPIKPPGPPINPKLKDKTRETADLVWTKPLSDGGS
PILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPREL
AESVIAKDILHPPEVELDVTCRDVITVRVGQTIHILARVKGRPEPDITWSKEGKVLVRDK
RVDLIHELPRVELHIKEAVRTDHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNV
TKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFR
VCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNL
SYHVERRLKGSTDWERVHKGSIKDTHYMVDKCVENQIYEFRVQTKNEGGESDWVNTEEVV
VKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKID
TGTESSKFSLTKAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKITDVSSDRC
TVRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSATVLVPGATVTRLIEGNEYIFRVRAE
NKIGTGPPTESKPVIIKTKFDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLE
KKEKHSARWVPVNKSAIPERRMKVQNLLPGHEYQFRVKAENEIGIGEPSLPSRPVVAKDP
IEPPGPPTNFKVVDTTKNSITLGWGKPVYDGGAPIIGYVVEMRPKIEDASPDEGWKRCNA
AAQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMR
KLVTVRAGCPIRLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDS
GKYSLTLVNPAGEKAVFVNVRVLDTPGPVADLKASDATKTSCHVSWSPPENDGGSQVTHY
IVEKREAERKTWSTVTSEVKKTSYQVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLAS
DPLSEPDPPRKLEVTEMTKNSAALAWLPPLRDGGSKIDGYIISYREEDQPADRWTEYSVV
KDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAG
KKLRIEAHVYGKPHPVCKWKKGEDEVITSSHLAVHKADNSSVLIIKDVSRKDSGYYNLTA
ENSSGSDTQKIKVIVMDAPGPPQPPFDITDIDADACSLSWHIPLEDGGSNITNYIVEKCD
VSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFGVPS
EPKNARVTKVNKDCIFVKWDRPDSDGGSPITGYLIERKERNSLLWVKANDAPVRSTEYPC
AGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVSKNSVSLIWARP
KHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLEENAQYQFRAIARTAVN
ISQPSEPSDPVTIVAENVPPRIELSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDG
TLVKPAEGIKMAMKRNLCTLELFSVTRKDSGDYTITAENASGSKSATIKLKVLDKPGPPA
SVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLI
EGHEYQFRICAENKYGVGDPILTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPAD
DGGSPITGYLLEKRETQAVNWTKVNRKPVIERTVKATGLQEGTEYEFRVTAINKAGPGKP
SDASKAAYAQDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSD
NWVRCNLPQKLQKTRFEVTGLMENVEYQFRVFAVNKIGYSDPSDVPDKHCPKDILIPPEG
ELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRC
ENVNKYDAGKYILTLENSVGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIVD
GGSPIINYVVEKRDAERKSWSTVTTECPKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGE
TRDAVKASETPGPVVDLKVMSVTKSSCRIAWKKPRTDGGSRIIGYVVDFLTEENKWQRVM
KSMSLQYSTKDLTEGKEYTFRVSAENENGEGTPSEITVLAKDDVVPPDLDLKDLPDLCYL
AKENSNFRLKIPIKGKPAPSVTWKKGEDLLATDTRVSVESSAVNTTLVVYDCQKSDAGKY
TITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAITLKWGPPKDDGGSEITNYIL
EKRDSVNNKWVTCASAVQKTTFRVTRLHEGVEYTFRVSAENKYGVGEGLKSEPIVAKHPF
DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTPIRMK
DFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLI
WTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNT
AGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAEDTIVLSAISILGKPLPKSSW
SRAGKDIRPSDIVQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVP
GPPGPIEISNVSAEKVTLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVA
TKLIQGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWK
RPIDDGGSEISGYHVERREKKSLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENKAG
IGPPSDASNFVLIKDAAYPPGPPSNAHITDTTKKSASLAWGKPHYDGGLEITGYIVEHQK
VGEEAWTKDTTGTALRITEFVVPDLQTKEKYNFRISAINDAGVGEPAVISNVEIVEREMA
PDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKTRANIENTESFTLLI
IPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVILHWDLPLI
DGGSRITNYIVEKREATRKSYSTVTTKCHKCTCKVTGLSEGCDYFFRVMAENEYGIGEPA
ETTEPVKASEAPLPPESLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTH
ITTVKALECVARNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQK
LVIARAGDHIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDS
GPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISN
YVVEMRQTDSTTWVELATTVIRTTYKATRLTTGMEYQFRVKAQNRYGVGPGITSASVVAN
YPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALV
PGNIFKSSGLTDGVAYEFRVIAENMAGKSKPSKPSEPMFALDPIDPPGKPVPLNITRHTV
TLKWAKPEYTGGFKITGYIVEKRDLPHGRWLKANFSNILENEFTVSGLTEDAAYEFRVIA
KNAAGATSPPSEPSDAITCRDDVEAPRIMVDVKFKDTVTLKAGEAFKLEADVSGRPPPTM
EWTKDGKELEGTGKLEIKTADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLD
RPGPPEGPLAVSEVTSEKCVLSCTPLMMSAKMITTCTETXNSRLAWTNVASDVQITKLKV
TKLLKGNEYIFRVMAVNKYGVGEPLESEPMLAVNPYGPPDPPKNPEVTAITKDSMVVCWD
HPDSDGGSEITNYIVERRDKAGQRWVKCNKRTLTDLRYKVSGLTEGHEYEFRIMAENAAG
ISAPSATSPFYKACDAVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIAL
PEEDEWQIVTPPSGLKATSYTITNLIENQEYKIRIYAMNSEGIGEPALVPGTPKAEERML
PPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLL
IVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKIKEITKTSVTLTWEPPL
IDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKIDQLQEGCSYYFRVLAENEYGIGLP
AETAESVKASERPLPPGKITLIDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWA
TCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNT
FTVLAGEDLKVDVPFIGRPAPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVG
HYVVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSITISWSPPKYDGGSSINNY
IVEKRDTSTTIWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLTSEPIVAQY
PFKVPGPPGTPFVTLSSKDSMEVQWNEPVSDGGSKVIGYHLERKERNSILWIKLNKTPIP
QTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKGSECYVARDPCDPPGRPEAIIVTRNSVT
LQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNVIDTHFEVTGLVEDHRYEFRVIAR
NAAGVFSEPSESTGAITVRDEVDPPRISMDPKFKDTVVLHAGESFKIDADIYGKPIPTIQ
WIKGDRELSNTARLEIKSTDFATSLSVKDAIRVDSGNYILKAKNVAGERSVTVNVKVLDR
PGPPEGPVAISGVTAEKCLLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDASVQTLSC
KVTKLLEGNEYIFRIMAVNKYGVGEPLESESVIAKNPFVVPDAPKAPEVTTVTKDSMIVV
WERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHNYEFRVSAENA
AGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEK
CDVSVGEWTMCTPPTGISKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPIIVEEK
LEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFT
SLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTDITKDSVSITWEP
PLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIEELQEGCSYYFRVIAENEYGMG
LPAHTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSDK
WSECARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAF
NSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSTDLTVLSIKETHKDD
GGQYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESITLSWNPPLYTGGCQIT
NYIVQKRDTTTTIWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDAIVA
QYPYKEPGPPGTPFVTAISKDSMVIQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTI
IHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIMVKRNE
ITLQWTKPEYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVI
AKNAAGTISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFKLEADVHGKPLPT
IEWLRGDKEIEESARCEIKNTDFKALLIIKDAIRIDGGQYILRASNVAGSKSFPVNVKVL
DRPGPPEGPVQVTGVTSEKCTLTWSLPLQDGGSDISHYVVEKRETSRLTWTVVSSEVVTN
SLKVTKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVPPGPPKSLEVTNIATDSMT
VCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAE
NAAGVGEPSPATVYYKACDPVFKPGPPINAHIVDTTKNSVTLAWGKPIYDGGSEILGYIV
EICKADEEEWQIVTPQTGLRATRFEISKLIEHQEYKIRVCALNKVGLGEAASIPGTVKPE
DKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGLN
YTQLSIDNCDRNDAGKYTLKLENSSGTKSAFVTVKVLDTPGPPQNLAVKEVKKDSVFLVW
EPPIIDGGAKIKNYVIDKRESTRKAYANVSNKCNKTSFKVENLTEGAIYYFRVMAENEFG
VGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGT
EKWSVVAESKVCNAVVTGLSSGQEYQFRIKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKL
PFNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETSTATILHIKESNK
DDFGKYSVTATNSAGAATENLSIIILEKPGPPVGPVRFDEVSADFVVISWEPPVYTGGCQ
ISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSNPLDSKPV
IVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNK
TPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITR
HNVTLKWKKPAYDGGSKITGYVVEKKDLPDGRWMKASFTNVLETEFTVSGLVENQRYEFR
VIARNAAGNFSEPSESTGAITARDEIDAPNASMDPKYKDVITVHAGETFVLEADIHGKPI
PDIVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV
KVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSSEV
PALNYKVTKLLPSNEYIFRVMAVNKYGIGEPLESEPVIACNPYKPPGPPSTPEVSAIAKD
SMVVTWARPIDDGGAEIEGYVLEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRV
AAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGTPVKG
YVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATIPGSV
VAQERIEPPEIELDADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEV
TSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVT
LSWEPPLIDGGAKITNYIVEKRETTRKAYATVTNNCTKNSFKIENLQEGCSYYFRVLASN
EYGVGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPENDGGSKITGYVVEMQT
KGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPS
VELPFNTFSVKARDQLKIDVPFKGRPQATVSWKKDGQTLKETTRVNVSSSKTVTSLSIKE
ASREDVGTYELCVSNSAGSTTVHITVIILDRPGPPGPIRIDEVSCDNVTISWNPPEYDGG
CEISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS
AVVAEYPFSPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKERSSILWSKA
NKILIADTQMKVTGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNI
TRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTTIQETYFEVTELTEDQRYE
FRVFARNAADSISEPSESTGPITVKDDVEAPRIMMDVKFRDVIVIKAGEILKINADIAGR
PLPVVSWAKDGIEIEERARTEIVSTDYNTLLTVKDCIRRDTGQYVLTLKNVAGTRSMAIN
CKVLDKPGPPAGPLEINGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSHLAWTICEGE
LRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTK
DFMTLCWSRPESDGGSDISGYIIERREKNSLRWVRVNKKPVYDLRVKSIGLREGCEYEYR
VYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTNITIGWVKPLFDGGTPIT
GYTVEYKTSDETDWTTAIQSLKGTEYTVSGLTTGAEYVFRVRSINKVGASDPSDSTDPQI
AKEREEEPVFDLDTEMRKTLIVKAGASFTMTVPFRGRPVPTVLWSKPDTDLHTRAYIDST
DCQTSLTIENANRNDSGKYTLTIQNILSAASLTLVVKVLDSPGPPTSIRVQDVTKESAVV
SWDVPENDGGAPVKNYHIEKREASKKAWVSVTNSCHRLSYKVTNLQEGAVYYFRVSGENE
YGVGVPAETKEGVKITEKPSPPEKLGVTSVSKDSVSLTWLKPEHDGGSRIIHYVVEALEK
GQKNWVKCAVVKATHHVVSGLRENHEYFFRVFAENQAGLSDPRELLLPVLVKEQLEPPEI
DMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINL
KESVIADAGKYEITAANSSGTTRTFLNIIVLDRPGPPTGPVVISDITEESVTLKWEPPKY
DGGSQVTNYIVLKRETSTTVWTEVSATIARNTIKVMKLTTGEEYQFRIKAENRFGISDHI
DSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVIGYHLEMKDRNSILW
QKVNKMVIRTTHFKVTTISAGLIYEFRVRAENAAGVGKLSHPSEPVLAIDACEPPRNVRV
TDISKNSASLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFIVSGLTQNS
QYEFRVFARNAVGSISNPSEIVGPITCIDSYGAPVIDLPLEYIEVVKYRAGTSVKLRAGI
SGKPDPTIEWYKDNKELQTNALVCVENTTDLASILIKDANRLNSGSYELKLRNAMGSASA
TIRVQILDKPGPPGGPIEFKTVTAEKITLFWRPPTDDGGAKITHYIVEKRETSRVVWSMV
SENLEECIITTTKIIKGNEYVFRVRAVNKYGVGEPLESDPVIARNAFVTPGPPSMPEVTK
ITKNSMTVIWNRPVVDGGSEVSGYLLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSEY
QYRVCAVNAAGLGPFSEPSDFYKAADPIDPPGPPAKIRITDSTKSSITLGWSKPVYDGGS
PVTGYTVEMKQGEEDEWTIVSTKGEVRTTEYVVSNLKPGINYYFKVSAVNCAGQGEPIEM
AEPAQAKDILEEPEIDLDVALRTSIIAKAGEDVQVLIPFKGRPPPTVMWRKDEKNLSSDT
RYSIQNTDLSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVTVKVLDTPAACQKLHLKH
VSRGTVTLFWEPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKVTDLSEKIPFF
FRVLAENEMGIGEPCDTTEPVKAAEVPAPIRDLSMKDSTKTSVTLNWTKPDFDGGSIITE
YVVERKNINEQTWSYAGITKTCEIEVGQLKEQSVLEFRVFAKNEKGLSDAVTIGPITVKE
LVITPEVDLSEIPGAQVSVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEHVRFSKTE
NKITLNIKNVRKEHGGKYTIILDNAVCRNVFPITIITLGPPSKPKGPIRFDEIKADSVIM
SWDVPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENR
YGVSQPLVSNIILAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKK
ERNSILWQRVNISSISGREYRVTGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVD
PPGIPDYIDVTRETITLKWNPPLHDGGSKIVAYSIEKRQGDDRWVRCNFTDVSECQYTVT
GLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGIIIKSGDSL
RIKAFVKGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNA
SGSTKADITVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPVTHYIIEKRETSR
LSWALIEDKCEAHSYTAIKLINGNEYQFRISAVNKFGVGRPLDSDPVVAQIQYTVPDAPG
IPEPSNVTGNSITLTWARPESDGGNEIQHYILERREKKSTRWVKVISKRPISETRFKVTG
LTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSK
PVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAVNGAGK
GDSCEVTGTIKAVDRLTAPELDIDANFKQTHIVRAGASIRLFIAYQGRPVPTAVWSKPDS
NLNIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDSPGPPGPIT
FKDVNRESVTLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCTRQILKVSDLAEGV
PYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSVVLAWLKPDHDGGSR
ITGYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSV
IIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKDTDRVSI
TTTKDRTTLSIKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSSE
SCVLSWAEPKDDGGTDITNYIVEKRESGKTSWQLVNSSVKRTQIKVTHLTKYMEYSFRVS
SENRFGVSKPVESAPIVAEHPFVPPSAPTRPEVYSVSATAMSIRWEEPYHDGGSKVIGYW
VEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPVMAQ
NPVDAPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIV
SDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAQLDARLQGDL
VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG
KYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYI
VERRETSRLNWVIVEDECPTLSYVVTRMIKNNEYVFRVKAVNKYGPGVPIESEPIIARNS
FTIPSQPGIPEEVGAGKEHIIIQWLKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVY
DTRLKVTGLMEGCDYQFRVTAVNTAGNSEPSGASNFISCREPSYTPGPPSSPRVVDTTKH
SISLAWTKPMYDGGADIIGYVLEMQEKDTDQWYRVHTNATIRNNEFTVPDLKIGQKYSFR
VAAVNVKGMSEYSESTAEIEPVERLEIPDLELSDDLKKTVTLRAGASLRLMVSVSGRPPP
IITWSKKGIDLASRAIIDTTESYTLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD
TPGPCPSVKVKEVSRDSVTITWEIPTTDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLY
RISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLAPTKLEVVDVTKSTVTIAWE
KPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRVRAQNEKG
MSEAREIVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAG
SKLRESERVTVETHTKVAKLTIRETTIRDTGKYTLELKNVTGTTSETINVIILDKPGPPT
GPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRL
TEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPE
DDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGK
PSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ
HEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDY
ELDERYQEGVFVRQGGVIRLTIPIKGKPLPVCKWTKEGQDVSKRAMIATSETHTELVIKE
ADRDDSGIYDLALENKCGKKAVYIKVKVIGSPNSPEGPLEYDDIQARSVRVSWRPPADDG
GADIIGYVLERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKS
EEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKW
VRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGE
LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSSKDRTKDRQFTVGGLL
EATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMKDVITKLGEAAQLSCQI
VGRPLPDIKWCRFGKELVQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVET
SSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVVYIGRPVPAITWFYGQKLLQNSENIT
IENTEHYTHLVMKNVQRKTHAGKYKVQLSNVLGTVDAILDVEIQDKPDKPTGPIVIEALL
KNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYF
RVSAQNTFGISEPLEVPSVVIIKSAFEKPSAPGKPTITALTKDSCVVTWKPPPSDGGAKI
RNYYLEKREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEP
VTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPVVKWYRQGKEIIADGLKYR
IQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKNLEGMGA
VHALRGEVISIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDA
GFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNY
IIEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE
DKTRAMNYDEEVDETREVCMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKT
FMAKFVKVKGTDQVLVKKEISILNMARHRNILYLHESFESMEELVMIFEFISGLDIFERI
NTSAFELTEREIVSYVRQVCEALEFLHSHNIGHFDIRPENIIYQTRRSSTVKIIEFGQAR
QLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQII
ENIMNAEFTFDEEAFQEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIENVSTKV
IRTLKHRRYYHTLIKKDLNMVVSAARISCGGAVRSQKGVSVAKVKVASVEIGPVSGQIMH
AVGEERGHVKYVCKIENYDQSTQVTWYFGVRQLENNEKYEITYEDGLATMYIKDISRFDD
GTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTTKKIKRRTDTMRLLERPPEFTLPL
YNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDKKYTFESDKGLYQLTIHSVT
IDDDAEYTVVARNKYGEDSCKAKLTITPHLPPSDTTLRPMFKRLLANVECQEGQSVCFEI
RVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS
TSCQAYLQVERLRYVKQEFKSTEERERHVQRQIDKTLRMAEILSGTETVPLTQVAQEALR
EAAILYKPAVSTKTVKGEFKLQQEEKKEERKLRMPYEVPEPRKYKQTTIEEDQHIKQFVP
MSDMKWYKKIRDQFEMPGKIDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKL
TQDDLEMVRPARRRTPSPDYDFYYRPRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLE
EELELGFSASPPSRSPPRFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPAKAETSTSYA
ELRERHARASYRQPKQRQRIMAEKEDEELLRPVTTTQRLSEYKSELDHMSKEEKSRKKSR
RQREVTEITEIEEEYEISKRAQKESSSSVSRLLRRRRSLSPTYIELMRPVSELIRPRPRP
AEESEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTS
ERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTCFILNVQSKPTAEVKWYHNGVELQE
SSKIHYTNTSGVLTLEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRR
DEDVPRSVFPELTKTEAYAVSSFKKTSEIEASSSVREVKSHMTATRESLSSSEHYASAEM
KSAALEEKSLEEKSTHRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVTWLR
GGQVISVSARHRVTTTKYKSTFEISSVQASDEGNYTVVVENSEGKQEAQFTLTVHKARVT
EKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPVTSHPKATSPPETKPIPTEKVQQLPV
SAPPKITQSLKAEASEDTAKLTCAVDSSVLCAKEITWYKDGKKLKENGHFQFHYSADGTY
ELKIHNLTESDCGEYICEISSEGGTSKTNFQFVGQAFKSIHEKLSSKSEAKKLAQKPAES
TEIKKMAPKAPEPISSKPVIVTGLQDTTVSSDSIAKFSVKATGEPWPTVIWTKDGKVITQ
GGKYKLSEDKGRFILEIQKTDISDSGLYNCTVTNSAGSVSSSCKLTIKVAKDSEAQRVST
QKTSETTSQKMAVVQEEIAQKALISEEIKMSDVKSQEKLALKEEASKVLISKEVKKSEAA
SLEKSFVHEEITKTSQISEDIKTHAEIKAFSTQMSITDGQKVTLKANIAGATDVKWVLNG
MELANSEEYRYGVSGSDQTLTIKQASHRDEGILTCIGKTSQGIIKYQFDMTLSKELSDAP
AFITQPRSQNVNEGQNVHFSCEISGEPSPEIEWFKDNLPISVSSNISVSRSRNVYSLEIR
NASVRDSGKYTIKAKNFRGQCSATASLTVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQ
MSASKQEASFSSFSSSSASSSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGQSSMTQLE
SSTRRMLKAGVRGIPPKIEALPPDISIDEGKVLTVACAFTGEPTPEITWSRGGRKIQNQE
QQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 102576 nt   +upstreamnt  +downstreamnt
atggcaactgaagcaccgacgtttaagcagccgttacaaagtgttgtggtactggagggt
agtaccgcaacctttgaggctcacgttagtggtttcccagttcctgaggtgagctggttt
agggatggccaggtgatttctacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgatgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcaactagcactgctgagcttcttgtgacagcggag
acagcaccacccaactttgttcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgtgtctccaagtgaaagtgactggaatccctacacctgtggtgaagttctatcgggat
ggagctgaaatccagagctcccttgattttcaaatttcacaagaaggtgacctctacagc
ttactgattgcagaagcataccccgaagactctggaacctactcagtaaatgctaccaat
agcgttggaagagctacttcaactgccgaattgctggttcaaggtgaagaagtagtaccc
gctaaaaagacaaagacaattatttcgactgctcagatttcagaaacaagacaaactcga
attgaaaagaagattgaagcccactttgatgccaggtcaatggcaacagttgagatggtc
atagatggtgctgctgggcaacagctgccacataaggcacctcccaggatacctcctaag
ccaaagtcaagatcaccaacaccaccatccattgctgccaaagcacaattggctcgacag
cagtccccatcaccaataagacactccccgtccccagtcagacatgtgcgggctccaacc
ccatctccagtcaggtccgtgtctccagctgggaggatctctacatcccccatcagatct
attaggtctccattactcgtccgtaaatcgcagacacctaccatgcccacgggcccagaa
gtgcctcccccttggaagcaagagggctatgtggcctcatctgagactcagatgagagaa
acaacaatgacaagtgctactcagatcaggacagaagaacgatgggaagggagatatggt
atccaggagcaagtgaccatcagtggggctgccggcgctgctgccagcgtgtcagccagt
gctgcctttgcagcagaggctgtggctactggtgctaaggaggtcaaacaagaaactgac
aaaagtgcagctgttgcgactgttgttgctgctgttgatatggccagagtgagagaacca
gttatcagtgctgtagagcagactgctcagaggacaaccacgactgctgtgcacatccag
cctgctcaagaacagataagaaaagaggcggagaagactgctgtaacaaaagtagtagtg
gccgccgataaagccagggaacaagaattaaaatcaagaaccagagaagtcattacaaca
aaacaagagcagatgcatgtaactcatgagcagataagaaaagaaactgaaaaagcattt
gtaccaaaggtagtaatttctacaactaaagccaaagaacaagaaacaagagttactgga
gaaattactacaaaacaagaacaaaaagaagtaactcaagaaacaataaaacaggaagct
gagacaactgctgcagccatggtggtagtggccgttgcaaagcccaaacaactagaaaca
gtcctgggtgctcaagaagaaatttccataaaacaagagcaaaagcacataactcatgaa
aagataatgaaggaaactaggaaaacagtggtacctaaagtcatagttgccacgcccaaa
gtcaaagaacaagatttagtatcaagaaccagagaaggcatcactaccaaaagagagcaa
gttcaaataactcaggaaaagatgagaaaggaagctgagaaaattgccttgtctacaata
gcagtagctactgcaaaagccaaagagcaagaaacaatactgagaactagagaaggaatg
gctactagagaagaacaaatccaagttactcatggaaaggtggacgttgggaaaaaggct
gaagctgtagccacagtcgttgctgcagtagaccaggcccgtgtcagagagcccagagag
cctgggcatcttgaagaatcatatgctcagaagaccactttggagtatggctacaaagag
cgtgtgtctgccgcaaaggtagctgagcatccccagcgtccagcctcagaaccccctgtt
gtccctaaagcagtcaagcctggagtggtccgtcctcctcctgagactcatatcacaact
actgatcaaatgggaatgcacatatcatcacagatcaagaaaacaacagacataacaact
gaaagattagtccatgtggataaacgcccccgcacagcaagccctcactttaccgtttca
aaaatttctgttcctaagacagaacatggatatgaggcatcaatagccgggacggctatt
gccacattacaaaaagagttgtcagccacaccttctgctcagaaggtcaccaaatcggtg
aagcctcctactgtgaagcctagtgagactaaagtacgggcagagcccaccccctcacca
cagttcccctttgctgacatgccagacacttacaagagtcaagctgacattgaggtgaaa
aagaaagtaggggtgagcatcactggtgccacagtccgtgaagagcgcttcgaagtactg
cacgagcgtgaagccaaggtaacagaaacagcaagagtgcctgcacctgttgaaatccct
gttactccaccaactttagtctcgggcttaaaaaatgtgactgtcatagaaggtgaatct
gtcaccttggagtgccacatctctggatacccgtccccagcagtgacatggtacagagaa
gactaccaaatcgaaagttccattgatttccagataaccttccacagtggaattgcccgg
cttatgattcgcgaagcctttgcggaagacagcgggcgatttacttgcagtgctgtaaac
gaggctggaaccgtcagcacctcctgctacctagctgttcaggtgtcagaagagtttgaa
aaggaaacaacagctgtggctgagaaattcaccacagaagagaaacgctttgtcgagtcc
agagatgtggtaatgactgatactagcatcacagaggaacaagcagggcctggagaaccg
gctgctcctttctttgttacaaagccagtggtccagaaactggtggaaggtggaagcgtt
gtgtttgaatgccaggttgatggcaacccaaagccccatgtctactggaagaaatctggc
gttcctctaacgactggatacagatacaaagtgagttatgacaaacaaactggcgagtgc
aaactggtgatttctatgacttttgctgatgacgctggagaatacactattgttattcgt
aataagcatggagaaacttctgcgtctgcttccttgcttgaagaagctgattatgagtca
ctgatgaagtcccagcatgaaatgctttaccaaacacaaatgactgcgtttgtgcaagaa
cccaaagttggagaaacagcacctggatttggatacgctgactttgaaaaagaatatgaa
aaagaacaggccttaattaggaagaaaatggccaaagatactgtaatggtcagaactttt
gtagaggaccaggaattccacatttcttcctttgaagaaagacttattaaagaaattgaa
tacagaataataaagactacattagaagaacttcttgaggaagacggagaagaaaagatg
tcggttgacatttctgaatccgaagctgttgaagcaggatttgatttaagaatcaaaaat
tatagaattctcgagggaatgggtgttacttttcattgcaagatgtctggatatccatta
cccaagattgcatggtacaaagatggcaagcgtataaaacatggagaacgataccagatg
gattttctgcaagatggcagagctagtctgcgtatacctgttgttcttccagaagatgaa
ggcatctatactgcatttgccagcaatatcaaaggaaatgcaatttgttcaggaaagctg
tatgtggagcctgctgcaccactgggagctccaacttacatacccacaccagagccagtg
agcagaatcagatctatctccccacgttcagtgagcaggtctcccatacgcatgtctcca
gcacggatgtctcctgcaaggatgtcacctgcacggatgtcccctggacgtagactggat
gaaacagatgagtctcaacttgaaaggctgtataagccagtctttgtattaaaacccact
tctttcaaatgtttagaagggcagactgccagatttgacttaaaggttgtgggtagacct
atgccggaaacattatggtttcatgatggccagcaaattgtcaatgactatacccataaa
atagtcatcaaagaagatggtacccaatcactgattattgtacctgcaacacccagtgat
tctggggaatggactgtgagaatggctcatgaaggtgcacttactggtgtanntacagat
cagaaagagaagcaaaagccagacatcgtcnntgtcccagaaccagtgagagtacttgaa
ggggagactgctagattccgatgccgagtgacaggctaccctcagcccaaagtcaactgg
tatctcaatggacagctcatccgcaagagcaaaaggttcagagttcgctatgatggcatt
cattatctggacattgtggactgcaaatcatatgatacaggtgaagtcaaagtcactgca
gaaaatcctgaaggtgtgacagagcataaagtgaagcttgagatccagcagagggaagat
tttaggtctgtccttaggcgagcccctgagccaaagccagaatttcacatacatgagcct
ggaaaacttcagtttgaagttcaaaaagtagacagacctgttgacaccactgaaaccaaa
gaaattgtgaagctgaaaagggctgaaagaattactcatgaaaaggtgcctgaagagtca
gaagagctgcgcagtaaattcaagcgcagaacagaggagggatattatgaagccattaca
gctgtagagctgaagtctcgcaagaaggatgaatcctatgaagaactcctaaagaagaca
aaagaagagcttctccactggaccaaagagttaactgaagaggagaagaaagccctcatg
gaagaaggcaaaatcactattccaacttttaaacctgataaaattgaactaagtccaagt
atggaggcccccaaaatcttcgaaaggattcaaagccagacagtaggccaaggatctgat
gcacacttccgggtcagagttgtggggaaaccagacccggagtgtgagtggtataaaaat
ggtgtaaaaatcgagcgctctgaccgaatctactggtactggcctgaagacaatgtctgt
gaactggtcattagggatgtgactgctgaggactctgccagcatcatggtaaaagccatc
aatatagctggagaaacctcgagccatgcattcctacttgtccaagccaagcaatcaatc
actttcacacaggaattacaagatgttgttgctaaggaaaaagacaccatggcaaccttt
gaatgtgaaacatcagagccatttgtcaaagtaaaatggtataaagatggtgtggaggtt
cattcgggagataaatataggatgcactctgacagaaaggttcacttcctttctgtactg
acaattgacacatctgatgctgaagactacagctgtgtccttgcagaagatgaaaatgta
aaaacaaccgctaaacttattgttgaaggtgcagttgttgagtttgtgaaagaacttcag
gacatagaagttccagaatcattttcaggagagttagagtgcattgtatccccagaaaat
atagaaggcaaatggtatcataatgatgtggagcttaaatccaacggcaaatacacaatt
acatctcgccgtggacgtcagaacctcacggtcaaggacgtgaccaaagaggatcaggga
gaatacagctttgtcatcgatgggaaaaagacaagctgtaaactgaagatgaaaccccgc
cccattgctattctacaaggacttagtgatcaaaaagtctgtgagggtgacattgttcag
ctcgaagttaaagtctccttagaaaatgtggaaggcgtctggatgaaagatggtcaagaa
gtacagtccagtgacagggttcacattgtaatagacaaacagtcacacatgctgcttatt
gaagacatgactaaggaagatgctggaaattactccttcactattccagctcttggactt
tcaaccagtgggcgtgtctctgtttatagtgttgatgtgctaacacctctaaaagatgtt
aatgtaattgagggtaccaaggctatactcgaatgtaaggtctcagtccctgatgtgact
tctgttaaatggtacttaaatgatgaacaaatcaagcctgatgatcgtgtacatgccatt
gtcaaagggacgaagcaacgactagtgattaatcggacccatgcttcagatgaaggacct
tacaagctgatggttggcagagttgaaaccagttgtaatctctctgtagaaaaaattaaa
attatcagaggtcttcgtgaccgtacttgtacagaaacccaaaatgtggtctttgaggtt
gagctgtcccactcaggaattgatgtcctgtggaattttaaggacaagggaaatcaaaga
ctcacactgtacttctcttgttccaaagggggagccatctccaagccactcacagatcag
actgtagctgagtctcaggaagctgtgtttgagtgtgaggttgccaacccagattcagaa
ggcgaatggttgaaggatggcaaacatctaccactcagtaacaacatcaaaagtgaatct
gatggccacaaacggagacttatcattgttgccaccaaactagatgacattggagaatac
acctacaaggtggccacctccaaaacatctgccaaactcaaagttgaagctgtcaaaatt
aagaaaactctgaagaacctcacggtgacagagacgcaggatgctgttttcactgttgag
ctcacacaccctaacgtaaaaggcgtccagtggatcaaaaatggggtcatgctgcagtca
aatgacaagtatgacatctctatcaaaggaacagtttacttgctgagaatcaaaaactgt
gctgttgtggatgagtctgtttatggcttcaggcttgggaggctaggagccagtgccaga
ctgcacgttgagactgtcaagatcataaagaagccaaaggatgtgactgccttggaaaat
gctactgttgcctttgaagtcagtgtctctcatgacacagttcctgtaaagtggttccac
aagaacgtggaaattaagcccagtggcaagcacagactggtctcagaaaggaaagttcac
aagctgatgctgcagaatatctccccctcggatgctggggagtatacagccgtggtgggg
caattggagtgcaaagccaaattgtttgtggagacattgcacattacaaaaaccatgaaa
aatatcgaggtgcctgagaccaaagctgcctcctttgagtgtgaggtgtcccacttcaat
gtcccttccatgtggctgaagaatggtgtggagattgagatgagtgaaaagttcaagata
gttgtgcaggggaaactccaccagctgatcatcatgaacaccagcacagaggactcggca
gaatacacgtttgtctgtggcaatgaccaagtcagtgccacgctgacagtgaccccaatc
atgattacatccatgctgaaagacatcaatgctgaagaaaaagataccattacatttgag
gtgactgtgaactatgaaggcatctcttacaaatggttaaagaatggggtggaaatcaaa
tcaaccgacagatgccagatgagaaccaaaaagcttacacactcactgaacatcaggaat
gttcattttggtgatgctgctgactacacgtttgtggctgggaaagctacatcgacagcc
accctttatgtggaagctcgccatatagaatttaggaaacacatcaaggacattaaggtt
cttgagaagaaacgagccgtgtttgaatgtgaagtttcagaacctgacatcactgtacag
tggatgaaagatggccaggaactacagattgtagaccggataaagatacaaaaggagaaa
tatgtccaccgccttctgatcccatccactcgtatgtctgacgctgggcggtacacagtg
gtggcaggaggcaacatgtctactgccaacctctttgtagagggaagagatgttcgcatc
cgaagtattaaaaaggaggtccaggttattgagaaacagcgtgctgtcgttgagtttgag
gtcaacgaagatgatgttgatgcccattggtataaagatggcattgaaatcaatttccaa
attcaagaacgacaccaatatgtggtagagagaagaatccaccggatgtttatctctgag
accagacacagtgatgccggcgaatacacttttgtggcaggaagaaataggagttctgtt
actctctatgtcaatgccccggaaccacctcagattctgcaggagctccagccaatcact
gtgcagtctggcaagcctgcccgcttctgtgcggtgatctctggcagaccacagcctaaa
attttctggtacaaggaagagcagctgctttccactggcttcaagtgcaagtttcttcac
gatgggcaagagtacacgcttttgctaatcgaggccttcccagaggacgcagctgtctac
acctgtgaagccaagaatgactatggagttgccacaacctcagcttcactttcagtggaa
gttccagaagttctgtctcctgatcaggaaatgccggtttatcctcctgccatcatcacc
ccacttcaggacaccatcacttctgaggggcagccagcccgttttcaatgcagggtttct
ggaacagatttaaaagtgtcttggtacagcaaagacaagcaaatcaagccatctcgattc
tttagaatgactcaatttgaagatacttaccaactggaaattgctgaagcttttccagaa
gatgaaggaatttacacttttgttgctagtaacatggtaggccaagtgtcaagcacagcc
aacttgagactggaagcccctgaatcaattttgcaggagaggatgggacagcagattgag
gtggagatgaaagagttttctaattctcttctgtctgctgaggaagaagagctccagatc
tatagctctgaccttcagttatctaataccaatgaaacacttgaactttggtctgaacct
ccagttcattcaactaaatttggttccaaaaaggcaggcagtgtcccagctttcatcaaa
gaagtttcaaatgctgaaataagcattggggatgtggctaaactgtcagttactgtcact
ggcattcccaagcctagagttcagtggttcttcaatggagtaatgttaaccccttctgct
gactacaaatttgtttttgattgtaatgatcatagcctgatcattctgttcaccaagttt
gaggatgagggagagtatacatgcattgctagtaatgaatatggaaaggcagtgtgtagt
gcctatctaaaaataaattccaaaagagagggacatgaggagacaggaacaaaattagca
gtggagaaaccagtggaaaagcttaaaggtccttgtcctccttacttccttaagaagtta
aaaccaattcagtgtgctcaagggctccctgccatctttgagtacatggtgcttggagag
cctggacccaccatttcgtggttcaaagaaaataagcagctttgcaccaacatttattac
actatcattcataatcccgatggctccgggacgttcatcgtcaatgaccctcagagggaa
gatagtggcctctatgtctgtaaagcagagaatgtgtggggtgagtccacttgtgcagca
gagttgcttgtacctctggaaggcacagacatgactgattccccctgcaaagtgaagtcc
atgccagaggctactgtagaagagggcatttctcaaatagattttccacagaagtcatca
ttaaaggacctttccattgagacctttgactcagaacaggaaactacaacttttgtaaag
gacaccattttgaaagctgctttgattgcagaagaaaagcagcagctttcttatgagcat
atagttaaaaccagtgaactgagcagtcaagttactttagaaactcagcaattgcaatcc
acagtcatgttggggcaggatatgcccactcctgaaagcaccagtgaactttccatcgat
ggtacaattctcattcattctctaaaggaaccatctcctagtttacagctacagactgtc
cagtcccaggaaaccctcccaaaagaagacatgctaatgcttgaagagcctgcatcacaa
gtgattctatcagatactgaaaaaatctttccaagtgccatgtccacggaagaaattagt
tcattaacagctgagcctctgcaaactttattagctgaacctgaaaggagttatccagag
tcttcagcggggccccagacagattcatgttttagcactgtggctgaggaagtacttcta
ccaaaagaaaagacagtgtctgcagtggacaacgagcagagagcaactcttcaaaagcaa
gaggcacacagtgctgtcatcctgactcagggcttagctgaggggtgcatggaaattttc
aagggtcctgacgttgcaatctctgaggtaaattacgagccccaggtcccttcagaacac
acatgcacagtagaagagggactcatgttagaaagtgcagatcagctagaaagtgcagga
caagattttgcagccaagcttgaggaaggcaaggctttaagctttccgctagcacttgag
gagaagcaggtgctgctcaaggaagaacattctgctaacttggcaatgactctgagccaa
accatcgagtgtaagagagagcccatgacgataagggaagtgcaggaggtacagggaagt
gacactctctctaaggaaaatttgcttgctgatattccagatgagcaacggttgaacctg
aaaactcagatccgcagggctctgcgagcagcagtggccagtgagcagccaagtcttttc
tctgagtggttaagagatattgaaaaggtggaggtcaaggccgtgagcctcacccaggag
cccaagcgcatcctgtgcacctaccttattacctcagtggcatctgtaacccaagaactt
accatcactattgaaggtattgaccctcaaatggctaacctgaaaactgaactgaaggat
gctttgtgttctattatatgtgaggaacaaaacatcttaatagctgaggatcccagaatt
cagaaaggagccaaaacacgttcgcaggaagaaacagttgcttcttcagattcacagaag
gtggaagtaatcactgaaccagaagctgaatctaaatatcttgtctcagcagaagaggtc
agctatttgcatgtgaacactcaggtcaaatttgtggctacagctcttagtgatggagtg
gttgcagctgctctctctgatgaaaagcaggatgacattctaaaactatcccaggcagaa
gagaagtcctccaaaagttgtactgaggaggttgacagagcaaaagtagaggaaactgaa
ggtagcctagtcacagaagattgtcctgttatatatacacccttggaggacaccattgct
gaggaaggtgatgccatatacctcacttcctccataacaaacgctaaagaggtgaactgg
tattttgagagtaaactggtgccgtcagatggaaagttcaagtgtttacaagatcaaaat
acatatacgttagtaattgacaaagtaaatacagaagaacatcaaggagaatatgcctgt
gaggccttgaatgacaacggaaaaacaacaacttctgcaaaactcactgtagtaaaaaga
gctgccccagtgatcaagaagagaatcgagcccctggaagtagctctgggccaccttgcc
aaattcacctgtgagatccaaggtgcccccaaggtccgattccagtggtttaaaggtggc
agagaaatttacgagagtgacaagtgttctattcgatctgcaaattatgtctccagcctg
gaaatcctgagaacccaggttgttgactgcggcgagtacacctgcaaagcttccaatgag
tatggcagtgtcagctgtacagccacactaactgtgacagaggcatatccaccaaccttt
tactccagacctaagtccgttacaacttttgtgggtaaggcagccaagttcctttgcacc
gtggtggggacccccacgattgaaaccatctggcagaaagatggggctgctctatctcct
tcacccaaccgcaggatttcacatgcagaaaacaaacacattttagaactctcaaatctt
acaactcaagatagaggagtttactcttgtaaggcttctaacaagtttggagccgacagc
tgccaagctgagttgatcgtaatcgacaaaccgcgtttcattaaagaattagagcctgtg
cagtccgcgatcaataagaagatacgcctggagtgccaagtagacgaagacagaaaagtc
acagttacatggaataaagatgggcaaaaactgccccctgggaaagattataagatctat
tttgaagataaaatagcatcacttgagatacctctggccaaactaaaagattcaggcact
tacgtctgcacggcttccaatgaggctggaagcagctcctcttcagcaacagtaactatc
agagagccgccatccttcgtgaagaaggtggatccctcttacttaatgcttccaggtgaa
tcagcacgcctccattgtaagctgaaaggctcacctgtgatccaggttacttggtttaaa
aataacaaagaacttaatgaaagtagtacagtccgaatgtcttttgccaaatcggaagca
atccttgatattatggatgtaaaagttgaagacagtggaaattactcatgtgaagcagtg
aatgacgttggcagtgacagctgcagtactgaaatagttatcaaagaacctccttctttc
atcaaaacccttgagcctgcagacgtagtgagaggaacaaatgccctacttcagtgtgaa
atctctggcactggaccatttgaaattagctggttcaaagacaagaagcaaattcgaagt
agtaaaaagtacaggttgttttctcagaagtctgtcgtgtctctggagatcttttctttt
aatagtgcagatgttggtgaatatgaatgtgtcgttgctaatgaagtcgggaagtgtggc
tgcagtgcaacacacttattaaaagaaccaccaacctttgtgaaaaaagtagatgatttt
actgcactagcaggacaaactgtcaccttacaagctgctgtgagaggttcagagcccatt
tatgtcacatggatgaaagaacaagaagccattaaagaagatggaaaaatcaaaatgagc
ttttccagtggtgttgcagtcttgataatccctgatgttcagattagctttgctggcaaa
tacacatgcctggccgaaaatgaagcaggaagtcaaacatctgttggggaattaatagtt
aaagagcctgccaaaatcattgagagagcagagctgatccaggtgacagcaggagaccca
gccacgctggagtacacagtcgcaggcaccccagaactaaagcccaaatggtacaaagat
gggagacctttggttgccagcaaaaagtacagagtaagctttaaaaacaatgttgcccaa
ctcaaattttattcggctgaactgcacgacagtggtcaatacacatttgaaatttccaac
gaagtaggcaccagctcctgcgagacaactttcactgtattagatcgagacattgctcca
tttttcaccaaaccattacgcaacgtggataccattgtcagcagtacctgcaggctggac
tgcaaaatcgctggctccctcccaatgagggtgtcctggtttaaggatggtaaagaaata
gcctcttctgacaaatacagaatagcgtttgtggaaggcacggcctctttggagataagc
agagtagacatgaatgacgcagggaacttcacttgccgagccacaaattctgtgggaagc
aaagacagcagcggagccctgattgtgcaagaaccacccagttttgtaactaaacccgaa
tcaaaggatgttctgccaggctcagcagtttgtctgaagagcacattccaggggtctacc
cctctcacaatcaggtggtttaagggtgacaaagagctggtttctggtggaaactgctac
atttacaaagaagctttagaaagttctctggagctctattcagtaaaaacctctgattca
ggcacctatacctgtaaagtcagcaatgtcgccggaagcacggagagcagtgcaaacttg
tttgtaaaaggacctgccatgtttgttgaaaaattagaaccatcacaactgttaaagaag
ggagacaccactcagctaacctgcacagtaactggcacccctccaattaaaataacgtgg
tttgtaaatgatagagaaattaaggagagcagaaaacacaaaatatcttttgtggagtcc
actgcagttctaaggcttacagatgttgccatcgaagacagtggcgaatatatgtgtgaa
gctcaaaatgaggctggcagtgaccactgcagtggtattataatagtgaaagagccacct
tactttaccaaagaatttaaggcaattgaagtgctgaaggagtatgatgtgatgttgctg
gccgaggtggcaggcacacctccctttgagatcacttggttcaaagacaacacgactctg
cgaagtgggaggaagtataaaaccttcattcaggatcagttggttagcctgcagatcctc
aagtttgtagctgcagatgctggcgagtaccagtgtcgggtgaccagtgaggtggggagc
agcacctgcagtgccagggtgactttaagagaacccccagcctttgtaaagaagatcgag
agcaccagctcccttcgaggaggcacagctgccttccaggccactctgaaaggctccgtt
ccaatcacagttacttggttaaaagacaatgaggaaatcacagaagatgacaatatcaga
atgacctttgagaacaatgtagccagtctctacctcaatggcattgaagtaaagcacgat
gggaaatatgtctgtcaggctaaaaatgacgcaggaatacaaagatgttctgcattactc
tcagtaaaagaaccagcaacaatcattgatgaggctgtgtctatagatgtcacccaagga
gacccagccactttgcaggttaaattttcaggaactaaggagatcactgccaaatggttt
aaagatggccaagaactgaccctgggccacaaatacaaaatcagtgtcactgacacagtc
tccgtattgaagattatctctacagaaaagaaagacagtggagaatatacttttgaggtc
caaaatgatgttgggagaagtagctgcaaggctagcattaatgtattagatcttatcatt
cctccctcattcaccaaaaagctgaagaaaatggacagtattaaaggatctttcattgac
ttagaatgtatagtggctgggtcacatcccataagcatccaatggttcaaagatgaccaa
gaaatttcagctagtgagaaatacaaattctcttttcatgacaatactgccttcttggaa
atcagtcacctggaaggtacagacagtggaacatacacttgttctgccaccaataaagca
ggccataaccagtgcagcggccatttgaccgtcaaagaacccccttacttcgtggaaaag
ccacagtcacaagatgttaatcctaatatgagagttcaattaaaggctcttgtgggtgga
actgcaccaatgacaataaagtggtttaaagataacaaagagttgcactcaggagcagct
cgctcagtctggaaggatgacacctccactgttctagagctcttttcagccaaagctgcc
gatactgggacctacatttgccagctaagcaatgatgttggcatagcaaccagtaaagcc
actctgtttgtaaaagaacctcctcaattcattaagaagcccagtccagtagtagtgttg
aggaatggacaatcaacaacatttgaatgccaaataacaggcactcctgaaatccaggtt
tcttggtatctggacgggaatgaaataacagccattgagaaacacggcatttccttcgtt
gatggtttagctactttccatatatctggtgccagggtagaaaacagtggaacttacgtc
tgtgaagctcgaaatgacgcaggcacggccagctgcagcattgaactaaaagtgaaagaa
cctcccacctttatcagggagttgaagcctgtggaagtagtgaaagatagtgacgtggag
ctggagtgtgaagttacggggacatctccatttgaagtcacatggctgaagaataacaag
gaaattcgaagcagcaaaaaatatacactgactgacagagtgtcagtgtttaacctccac
ataaccaggtgtgacccttcagacactggtgattaccagtgtattgtatccaatgaagga
ggcagctgctcttgcagtactaaagtctccctgaaagaacctccatcgttcactaagagg
atagaaaatgtcactgctgttttgaaaagttctgccacctttcagggtactgtggcaggg
tctccccctattttgataacctggctcaaggatgatcagattctagatgaagacgataat
gttcatatgtcctttgtgaacaatgtggctgcgcttcaaatcagaagtgtggataatggg
cacagtggaagatacacctgtcaggccaagaacgaatcaggtgttgagaggtgttatgcc
ttccttctagtacaagaacctgctcaaatcatagaaaaggcaaaatctgttgatgttacg
gagaaagacccggtgaccttggaatgtgtcgtggctggaacaccagaactcaaagttaaa
tggctcaaagatgggaaacaaattgtgcccagtagatacttttcaatgagtttggaaaac
aatgtggccagttttaggattcagtcagtaatgaagcaagacagtggtcagtatactttc
aaagtggaaaatgactttggaagcagtagctgcgatgcctacctgagagtactagatcaa
aatatccctccatcattcaccaagaaattgaccaaaatggataaagttctgggctcttct
attcatatggagtgcaaggtttctggctcacttcctattagtgctcagtggtttaaggat
ggaaaagaaatatctacaagtgcaaaatatagacttgtatgtcatgagaacaccgtgtca
ctggacattaataatctggaattagaagatactgcaaattacacatgcagagtgtccaat
gtagcaggggatgatgcatgcagtggcatcttaactgtgaaagaaccaccaagcttccta
gtgaaacctgagcgacagcaggccatacctgattcgacagtggaattcaaagcagtacta
aaaggaacaccaccatttaaaataaagtggtttaaggatgatgtggaacttacctctgga
cctaagtgttttattggcttggaagggtcaactagctttttaaatctctactcagtggat
gcttctaagactggacaatatacttgccaagttaccaatgatgttggcagcgactcttgt
actacagtgttgcttgtgacagaaccaccaaagtttgtaaagaaattagaagcatctaaa
atcgtgaaagcaggtgattcagcacgacttgaatgcaagatagctggatccccagaaatc
agagtaatgtggtacagaaatgaacatgaacttccaccgagtgagaaatacagaatgact
ttcattgactcagtggcagtcatacagatgaacaatctcggcaccgaggacagtggggac
ttcatttgtgaggctcagaatcctgctggcagcataagctgcagtaccaaggttatagta
aaagaaccacctatttttagcagcatccctcctgtagtagaaactcttaaaaacactgaa
gttagtcttgagtgtgaacttttgggaacaccaccatttgaggtggtgtggtataaagac
aagcgtcaactccgaagtagcaagaaatacaagattgcatccaaaaacttccatgcaagc
attcacattctaaatgttgaaacctcagatattggtgaataccactgtaaggcacagaat
gaagttggaagtgatacttgcatttgtactgtaaatttaaaagaacccccaagatttgtc
tccaaactgagcagcctcactgttgtagctggtgagccagctgagttacaagcatccata
gaaggtgcccagcctatttctgttcagtggcttaaagagaaggaagaagtaattagagaa
agtgaaaatatcagaattacatttgtggaaaatgttgcaactctacagtttgcaaaagca
gaaccagctgatgctgggaagtatatctgtcaagtcaagaatgatggaggaatgcgggag
aacatggccactctgactgttttagagcccgcagtcattgtcgagaaggcaggaccaatg
acagtgactgtaggagaaacgtgcaccttggagtgtaaggtggctggcactcccgaactc
tcagttgaatggtacaaggatggaaaactgttgaccagcagccaaaaacacaaatttagc
ttcttcaacaaagtctcttctttaaagattctctctgttgaaaagcaagatgcaggaaca
tacactttccaggttcaaaataatgttggaaaaagtagctgcacagctgtgattgatatt
tcagaccgagcggttcctccgtctttcacacgaagactgaaaaatatcggtggggtgctg
gggacctcttgcatcttggagtgcaaagtagctggatcctctcctatctctattgcctgg
tttcatgagaaaacaaagattgtcagtggagccaagtaccaaaccatattttcagataat
gtctgcactttgcagctaaattccctggactcatcggatatgggcagttacacatgtgtg
gctgctaatgttgctgggtctgacgagtgccgtgcagtgttgactgtacaagaaccaccc
tcttttgtgaaggaacctgagccttcagaagtactaccaggcaaaaatgtaaccttcaca
agtgttattagaggaacccctccattcaaggttggctggttcagaggtgccagggaacta
gtgaaaggagacaagtgcaacatctactttgaagacactgtggcagaactggaattattt
aatgtcgatgtatctcagagtggggaatatacctgtgtggtttctaatgatgctggccat
acattctgcacaactcgtctctttgtcaaagaaccagctgcatttgtgaagaaattgagt
gatcaatctgtagaaccagggaaatcaataattctggagagcacctatactggaaccctt
ccaatttcagtcacctggaaaaagaatggttttaacataactcagtctgaaaaatgcaac
attgtcacaacagagaaaacttgcatcttggaaattctcaatagcaccaaaagagatacg
ggacagtattcctgtgagattgaaaacgaggcaggaagggatgtttgcgaagctctggta
tccacattagaacctccttattttgttacggaactggaacctctggaggcatccgttgga
gattcggtatccttacaatgccaagttgctgggacaccagaaattacagtgtcttggtac
aaaggagacaccaagttacggccaactcctgaatataggacctacttcacaaacaatatg
gccacgcttgtttttaataaagtgaatatcaatgacagtggagagtacacatgtaaagca
gaaaatagtataggaactgcttcttctaagactatcttcagaattcaagagcgccaactt
ccaccttcctttgcaagacaattaaaagacattgaacaaaccgttgggttaccagttaca
ctcacttgtcgattaaatggctcagcacccattcaagtgtgctggtataaagatggtgta
cttttaagagatgatgaaaacctgcagacatcatttgtagataatgtggcaactttaaaa
attttgcagactgacttgagtcactctggccagtactcttgctcagcttccaatccactt
gggacagcatcttctagtgctaggctgacagcaagagaacctaagaagtctcccttcttt
gacatcaagcctgtatctatagatgttattgctggagaaagcgctgattttgagtgtcac
gttactggtgcccaaccaatgcgaatcacttggtcaaaagataacaaggagatccgtcct
ggaggaaactatacaatcacgtgtgtgggaaacactccccacttgagaattcttaaagta
ggcaaaggagactctggtcaatacacttgtcaagcaaccaatgatgtcggcaaagacatg
tgctcagctcaactcagtgtaaaagaacctccaaagtttgttaagaaattagaagcttca
aaagttgcaaagcagggagaacccgttcaactggaatgtaaaataagcggttccccagaa
atcaaagtcttgtggttccgcaatgacagtgaacttcatgaaagctggaaatacaacatg
tcgttcattaattccgtggcactgcttaccatcaatgaagcgagcactgaggacagtggg
gactacatctgtgaagctcataacggtgttggtgacgcaagctgcagcacagcactgaca
gttaaagctcctcctgttttcagccagaagccttctccagttggagcccttaaagattct
gatgttattttacaatgtgaaatttcgggaactcccccatttgaagtggtgtgggttaaa
gatcgaaaacaagttcgaagcagcaagaaatttaaaatcacttcgaaaaactttgatact
agtcttcatatccttcgttttgaagcctctgatgtaggcgaatattactgcaaagctgct
aacgaggtgggaagtgacacgtgtgtttgcactgtgaaattcaaagaacctccacgattt
gtgaaaaagttaagtgacacctcaacccttgttggggatgccgttgagttgcaggctgta
gtggaaggcttccagccaatttctgttgtctggctgaaaaatggtgacgttatcagagag
agtgaaaataccaggatttcattcatggataacattgcaactctccaacttggaagcccg
gaagcatctaattctggaaaatatgtgtgccaaatcaagaatgatgccggaatgagagag
tgctcggcagttttgaccgtactagagccagccagaatcacggagaagccagagcccatg
acggtcaccacggggaacccttttgcgttggagtgtgtggtgactgggacaccagagctt
tcagccaggtggttcaaagatggaagagaaatatctgcggacagcaaacatcacatcacg
ttcgttaacaaagtggcttccctcaaaatcccctctgcagaaatgagcgacaaggggcta
tacagctttgaagtgaaaaacagtgttggtaaaagtaactgcactgtgtctgtccatgtt
tccgatcgcgtcgtgcctccttccttcatccgcaagctgaaagacacaaatgccatcctg
ggggcctccgttgttttggagtgccgagtctctggctctgccccgatttcagttggctgg
tttcaagatggaaatgaaatcgttagcgggcccaaatgtcattccagcttttcagaaaac
gtctgtaccttgaatctaagcttgttggagccctccgacacagggatatacacatgtgtg
gctgccaacgtagctggttctgaggaatgctcggctgtcctgacagtccaagaaccacca
tcttttgaacaaacccctgattctgtggaagttttaccgggaacgagtcttatattcacc
agtgtctttagaggcactcctcctttccaagtcaaatggtttaaaggcagcagggaattg
gtgtcaggcgagtcgtgcaccatctctctagaagactttgtcacagaactggagttgtta
gaggtggagccactacagagtggagactattcttgccttgtaactaatgacgcaggcagt
gcttcctgtaccacacatctttttgtgaaaggtttgttcttttctctaattcatgtattg
ctttttcatttttctcaatcttcattggagaagggatttttaacctcatgttttctcctt
atagaaccagccactttcgtgaaaagattggctgatttcagtgttgagtcaggaagcccc
atagttcttgaggccacatattctggcacacctccgatctcagtaagctggatgaagaat
gaatttcctctttcacagtctcagaattgcagtattaccatgacagaaaaatcaacaata
ctggaaattcttgagagcacaatagaagattatgcacaatacagctgcctgatagaaaac
gaggctggtcaagacatttgtgaagcactggtgtctgtcttagaaccaccttattttatt
gaacctctggaacatgtggaagcagccattggagaacctacaactttacagtgtaaagtg
gatggaaccccagaaattagaatttcttggtacaaagaacacacaaaactacgatcagct
cctgcatataaaatgcagttcaaaaataatgttgcctcactagtaatcaacaaagtagat
cacagcgacgtgggagagtacacatgcaaggcagagaacattgtgggggcagtcgcttct
tcagctgtgcttgttatcaaagagcgcaaacttccaccttcctttgcaagaaaactgaag
gatgttcaggagattcttggcttcccagttgcatttgaatgtcgcatcaatggctcagaa
cctcttcaagtgtcttggtacaaggatggggtacttttgaaagatgactctaatttgcaa
acatcttttgttcgtaatgtagcaactcttcagattttgcaaactgaccagagccatgtt
ggtcagtacaattgttcagcttctaattcttttgggactgcttcatccagtgccaagctc
attctcttagaacatgaagtgcctcctttctttgatctgaagcctgtatcagtagatctt
gctcttggagaaagtggttcttttaaatgccatgtaactggaactgctccaatcaaaatc
acctgggccaaagataaccgagagattcgccctggaggcaactacaagatgactttggtt
gaaaatactgccactctgacagttctcaaagtaggcaaaggcgatgctgggcagtacact
tgctatgcaagtaacgtcgctggaaaagattcttgttatgcccaactgggtgtacaagaa
ccacccagattcattaagaagctagaaccttcaagaattgtgaaacaggatgaatacacg
agatacgaatgcaaaataggcgggtctccagaaattaaagttttatggtacaaagaagag
actgaacttcaagagagtagtaaagtcagaatgtcgtttgttgactcagtggcggtgttg
gaaatgtacaatctcagtgttgaggacagtggagactacacatgtgaggcccacaataca
gcaggcagtgcaagcagcagcacctccctaaaagttaaagaaccacccattttcagcaaa
aaacctcatcctattgagacactgaaaggagctgatgttcaccttgaatgtgagcttcag
ggtactcctccatttcaagtttcttggcataaagacaagagagaacttagaagtggcaag
aagtacaagataatgtctgaaaacttccttacgagtattcacatcctgcatgttgatgct
gcagacatcggggaatatcagtgtaaagccataaacgatgtggggactgacacttgcatt
ggttctatcactctgagagcaccacccagatttttgaagacgcttagtgacatttctact
attgttgataaagaagttcagctgcagactactattgaaggcgctgagccaatttctgtg
acatggttcaaagataagggggaaatcgttagagaaagtgacaacatatggatttcttat
tcagaaaacattgcaaccttacagttctcaagagcagaaccaggcaatgcaggaaaatac
acctgtcagatcagaaacgatgctggaatgcaggagtgctctgccacactatctattctt
gagcctgcagcaattgtggaaaagccggaatccataagtgtgacttcaggagatacctgt
accctggagtgtatagtaaccggaacaccagaactcagtactaagtggtttaaggatggg
aaagaactgatgagtgacagcaaatacaaaataagcttcttcaacaaagtatcaggcctt
aagattatcagcgtaacccctaatgacagtggggtatacagttttgaggtgcaaaaccct
gttggcaaagacagctgcacagcctctgttcaagtttcagaccgaattgtacctcctgca
ttcacaagaatattgaaggagaccagtggtctttctggttcctcggttgtgatggagtgc
aaagtctatggatcacccccaatctctgtctcctggttccatgaaggaaatgagatcagc
agtggaagaaaataccaggccactctgaccgataacacatgtgctttaactgtaaacgtg
ctggaagaatcagatgctggctactacacgtgtgtcgctactaatgtggctggttctgac
gaatgtggtgcatctctgactgtgagagaaccaccatcttttgttcagaaacctgattcc
atggatgttttaactgggacaaatgtaactttcacaagcatcataaaaggaacacctccc
ttcagtgtcagctggttcaagggcagcagtgagctagtaccaggagatagatgtaatgtg
tctttggaggagtcagttgctgagctggagttgtttgatgtagatacatcactaagtgga
gagtacacctgcatagttagtaacgaagctggcaaggcttcttgtacagcacatctctat
gtaaaagccccagcgaagtttgtcaagaggctcaatgattacagcatagagaaagggaaa
cccttgatcctagaaggcacatacactggaactccacctgtttcagtcacatggaagaaa
aatggcataaatataattccttctcagagatgtactatcaccacaactgaaaaatctgca
atcctggaaatcccaagcaccatggtagaggatgcaggacaatacaactgctacattgaa
aatgcttctggaaaagattcttgttcagcacaaatattgatactagaaccaccgtatttt
gtcaagcagttggagcctgttaaggtgaccgttggagattctgcctctttgcaatgccaa
cttgctggaacccctgaaattgcggtatcctggtataaaggagatacaaaactgagaccc
actgatacctacaaaatgcactttagaaacaatgtggctacactggttttcaaccaggtt
gacagtaatgacagtggagaatatatctgcagagccgaaaacagtgtgggagaagtttct
tcatcaactttcctcactgttcaagagcaaaaacttccaccatcattttctcgacaattg
agagatgttcaagaaacagttggattgccagttgtttttgaatgtgccatacgtggatca
gagcctatctcagtgtcttggtataaagatggcaggcccttgaaagatggccccaacata
cagatatcatttttagataatgtggccactctcaatatttttaaaacagatcggagcctt
gcaggccagtattcttgcacagctacaaatcctataggctctgcttcttctagtgccaga
ctcattcttacagagggaaagaacccacctttctttgacatccccttggcccctgtggat
gctctggcaggagaaagtgctgactttgagtgccacgttactggaacacaaccgataaag
gtcatctgggccaaagataacagagagatacgaagtggtggaaactaccagattagttat
ctggaaaacagtgcccacttgacaatcctgaaagttgacaaaggagactctggacaatat
tcctgctacgctgtaaatgaagtgggaaaagactcctgctctgctcagcttaatataaaa
gagcggctgatcccaccaagtttcactaaaaaactctcagaaacagtagaagaaacagaa
gggaattctttcaagcttgaggggcgtgttgctggttcccagcctataactgttgcttgg
tatagaaacaatgtggagatacacccaacttctaactgtgaaataacattcaaaaacaat
gcattactgctgcaagtaaggaaagcaggcatggccgatgctggtttgtacacctgcaag
gtgtcaaatgatgcaggttctgctctgtgtacatcttccattgtcatcaaagaacctaag
aagcctccggtgtttgatcagcaccttacctcagtaacagcaagtgaaggagaattcgtg
cagctgacctgccatgtccaggggtccgagccaattaggatccagtggttgaaggctggc
agggaaataaagccgtcagacaaatgcatcttcagctttgctaacagaacagctgtgctg
gaactcaaggatgtggctaaagcagattcgggagattacgtatgcaaagcttcaaatgtg
gctggaagtgacacgtccaaagcaaaagtggccattaaagacaaaccagctgcggtccca
gtagccaagaaggcagccatagatggaagactcttctttgtatcagaacctcagagtatt
agagttgtagaaaaaaccactgcaacattcattgcaaaagttggaggtgatccaatccca
aacgttaaatggacaaaggggaaatggagacaactgaaccaagggggtcgcgtttttatc
caccagaaaggggatgaagcaaagctggaaattagagataccacaaaaacagattctgga
ttatacagatgtgttgcatttaacaagcatggtgaaattgaaagtaatgttaacctacag
gtggatgaaaggaagaaacaagagaaaattgaaggagatctgagagcaatgctaaaaaag
actccagtcttaaagaaaggacctggagaagaagaagaaattgatatcctggaacttctc
aaaaatgttgatcctaaagaatatgaaaaatatgcccgcatgtatggaatcactgacttc
cggggtcttcttcaagcgtttgaactgctaaagcaaagtcaaggagaagaaacacataga
ttggaaattgaggaaatagagaagtcagaaaaggaagaaaaggaatttgaggaacttgta
tcatttattcagcaaaggctatcacaaacagagcctgtcactctgatcaaggatatcgaa
aaccagacagttttgaaagacaatgatgccatctttgaaattgacattaagattaattac
ccagaaatcaagctttcatggtacaaagggactgaaaaactggaacccagtgataagttt
gaaatactcattgacggtgaccgacatacactccgagtcaaaaattgtcagcttaaagat
cagggcaattacagattggtttgtggaccacacattgctagtgctaaactaactgtaatt
gagcctgcttgggaacggcatcttcaggatgttactttaaaagaaggccagacttgcacc
atgacttgccagttttctgtgccaaatgtcaaatctgaatggttcagaaatggcagaatc
cttaaaccccaaggaagatataaaacagaagtggaacacaaggtccataaactgaccatt
gcagatgttcgagcagaagaccagggtcagtacacctgcaaacatgaagacctggaaact
tcggcagagctcagaattgaagctgaaccaattcagtttacgaggcgcatacagaacatc
gtggtgagtgagcatcagtcggccacctttgagtgcgaagtctcctttgacgacgccatt
gtcacatggtacaaaggaccaacagaactgaccgagagccagaaatacaactttaggaat
gatggtcgctgccactatatgaccatccacaacgtgacgccagacgacgaaggtgtctat
tcagtaattgctcggctagagcccagaggcgaagcgagaagcacagcagagctgtactta
acaactaaagaaatcaaacttgaactgaagcctcctgatatccccgactccagagttccg
atcccaactatgcccatcagagcagtaccaccagaagaaattcctcctgtggttgttcct
cctatccctcttttactaccaacacctgaagaaaagaaaccaccagcaaaacgggtggaa
gtgagcaagaaggctgtgaaaaaagataccaaaaaagttgtcgccaaacctaaagaagaa
gcaccacctaaagaggttgtcaagaagcccctacctcctactgccttaatcccagcaaaa
gctcctgaaattattgatgtatcctccaaggctgaagaagtaaaaataatgaccataagc
agaaagaaagagattcagaaagaaaaaggagctgtatatgagaaaaaggaagcagtctat
gaggagaagaaagtttttatagaatcttttgaagaaccttatgaggaactggaagtggaa
ccttacacggagccaaccgaagaaccttattatgaagaaccagaggaagactatgaagag
accaaggtagaagctagaaaggaatttcatgaggaatgggaagaagattttgaagaaggg
caagagtactatgaaagagcagaaggttatgacgaaggggaggaagactgggaggaggct
taccgagaaagagaagttattcaagttcaaaaggaggcttatgaagaagcacatgagagg
gaaattccagcaaaagtgcctgaagagacagaagcactgcctcctaaagttgttaagaag
ccagtagttgaaaaaattgaaaagacttcccgaagaatggaggaagaaaaagttcaagtc
accaaagtaccccaagtttcgaagaagattgttccacaaaaaccttcccggattccagta
caggaagaagttattgaagtgaaagtaccagctgtgcaagcaaagaagatggttgtttca
aaggaagagatgttctttgctgcttacacagaggaggaggtgtcagttacagtccctgag
gtacaaaggaaaactgttactgaagagagagttcacgttgctgtttccaaaaagattgaa
cctccacctaaagtccctgagccacctaagaaaccagtcccaggagaagtggtccctgtt
cccattcctaaaaaggcggagcccccagcagccaaagtgcctgaggttcccaagaaacct
gtgcctgaggagaaaaagcttgttcctgaacccaagaaagaagttcctgctcccgcaaaa
gtcccagaggtgcctaagaaacccgtgcctgaagaaaaagttccagttcctgttgcaaag
aaaaaggaagctccaccagctaaagttcctgaagtagagaaaagagttgtcacagaagaa
agaataacagtggttactcaaagagaggaatctccgccaccagcagtgccagaaatacca
aagaagaaagttccagaagaaagaagactcattcctcagaaagaggaagaagctccacca
ccaaaagtgccagctttacgtaagaaacctgtcccagaggagaaagctccagtgcctgtc
cctgtcacaaagaaagctcctcctccccgagctgaagtttctaagaaaattgttgcagaa
gaaaaaagatttgttgccgaagaaaaacaatcatttgcagttcctcagagcgtggaagtc
atgcggcacgaagaggaggaatggagttatgaagaagaagaaagaatttctgtttcagtt
tatagagaagaggaaagagaagaggaagaggagaaagtggaggttacagaatatgaagtg
atggaagagcccgaagaatatgttgtagaagaaaagctgcaccttattgccaagagagtg
gaagctgaaccagccgaagtacctgaggagcctcggaaaattgtaccaaaaccgaaagtc
cctgctaaaaaagaggagcctccgccagctgaagttcctgaagcacctaagaaaattgtg
ccagagaagaagattcctgctgcagttcctaaaaaggaaaaggtgccaccagctaaagta
ccagaagagccaaagaaaccagttccagaaaaaagggctcctccaaaagcagttacagta
gaagaacctcccgcagccagagtgactgagaggcacaagcaaattagccaagatgaaaaa
gctcatgttgctgtaactaaaaaagaggaggctccaagggcaagagtgccggaggaacct
aagagagctgtcccagaagaaaaagttccaaaactcaaacctaaaaaagaggcggagcca
ccagctaaagtggctgaaatcagaaaaagagctgttagagaagagaaagtatccattgaa
gttccaaaaagagaacctgatcgtgctaaagaagcaataactgtaacagaagagaaaaag
tggtcttacgcccaagaagaagaaactatttcggtacaacgtgaagaggagtatgaagaa
tatgaagaatatgattataaagaatttgaggagtatgaaccaacagaggagtatgaccaa
tatgaagaatatgaagagcgtgagctcgaacgttatgaagagcatgaagaatatgtcaca
gaacctgagaagcctatcccagtaaaacctgtccaagaagaaccagttcccataaaacca
aaggccccaccagctaaagtgctgaagaaagctgtccctgaagaaaaagtaccagtgccc
attactaagaaaatcaaacctccaccacccaaagtgcctgaggaaccaaagaaacttgtt
gaggaaaagatacatatttcagttaccaaacgagaaaaagaacaggtgactgaaccagct
gctaaagtgcccatgaagcccaagagagttgtcccagaagaaaaagtacctgtccctaaa
aaagaagtagcagtacctgtccctaaaaaggaagtagcagcacctgttagagtcccagaa
gtgcctaaaagaccagaaccagaagagctcgccttagcagaggaaggtgtaactgaagta
gaggaatatcttgtcgaagaagaagagtacattcatgaagaagagtacgttcatgaagaa
gagtatgttcatgaagaagaatatattcatgaagaagagtacattcgtgaggaagaggag
cttgtaactgaggaagaagtggtcccagtaataccagtcaaagtgcctgaggtacctaag
aaacctgttccagaagaaaagaaacctgttcctgttcctgttcccaaaaagagggaagct
ccaccagcaaaagtgcctgagattcctaagaagccagaggagaaagttcctgtgcccatt
cctaaaaaagagaaggctccaccagctaaagttcccgaagtccccaagaaacctgtagca
gaggagaaagtaccaataccagttcctaaaaaggtggaagccccacctgcaaaagtgccc
gaggtacccaagaagcctgtacctgagaagaaggtgccagttcctgctcctaagaaagta
gaggctccaccaactaaagtgccagaggtacccaagaagcccatcccagaagaaaagaaa
ccaacacctgttgcgaaaaaagtagaagctccaccagccaaagtgccaaagaaactcgaa
ccagttccagttcctgtagctctgcttcgggaagaagaacttccatttgaagaagaaatt
gctcctgaagaggaagttccatctgaggaagaagaagttcctcctgaggaagaggaagtt
cctcctgaggaagaagaagttcctcctgaggaagaggaagttcctcctgaggaagaggaa
gttcctcctgaggaagaggaagttcctcctgaggaagaagaatttgtacctgaggaggaa
gttgtacctgaagaagaggaagttcttccagaaattaaacctaaggtgccagttcctgca
ccagtgccaaagaaacctgtaccagagaagaaagtccctgttctcactcctaaaaaagtg
gaacctcctccaccagccaaagtgcctgaggttaagaagaaagtgccagagaagaaagtg
gccgttcccaagaaagaggaagctcctcccgcggcagtgcctgtggtacctaagaaacct
gaaccagaaaagaaggtgcctcctcctggccttaagaaagcagtgccacctcctgccaaa
gttcctgaggtacctatgagagtggaagaaagacgagttgtgctccctaaagaagaggaa
gttgcaccagttgaagtgtttgaggaacctgaagagcctattctggaggaagagatcata
gaagaaccacctagcatagaggaggttgagacggtggtgccacctagagtgcctgaagta
gttaaaaaaccagaacccgaagcacctactcctgttcctaaaaaagtggaggctccacca
gctaaagtgccaaagaaagttcctgaggaaaaagtacctgttcctgttcacaaaaaagag
gcacccccagccaaagtgcctgaagtacaaaagaaagtcccagaaaagaaaatccctgaa
aagaaagtcccagaaaagaaaatccctgaaaagaaagtccctgtgcctaaaagagaagct
gttctcccaactaaagagagaactgtcttcgaagaaaaaatatcagttgccttccacaaa
gaggaagtagtaaaagaaagactagaagtagaagcaagagtggaagaatttcttggagaa
gaagagttccatgaagttgaagaacattttgaaaaagaagagttccatgaagtagaagaa
ttcatcaaagtagaagaacatagggttgaagaagtacacgaagctgaggaagtccacagg
gaaataaaagtcttagaggttgaagaagtagaagtatatgaagaacctaaagctccacca
caagggcctgagatatctgagaaaattgtgcctcccaaaaaaccacctattaaagttgtt
cctcgaaaagaacctccagctaaagtacctgaggtacccaagaaaactgtcatagaagaa
aaagtacgtgttcccgaagaacccaaaattccaccagtaaaggtacctgaagctcttcct
gaggctcccaaagaagtggtccctgaaaagaaagtgcctgtggcacctcctaaaaaaccg
gaagccccacctgctaaagtacccgaggctcccaaagaagtggtccctgaaaagaaagtg
cccgtggcacctcctaaaaagccagaagccccaccagccgaagtacccgaggtgctaaag
gcagctgtcccagaaaagaaggtgcctgaagtgatcccccccaaaccgggaagtccgccc
cctgcagtacccgaggctcccaaggaagtggtccctgaaaagaaagtgcccatggcacct
cctaaaaagccagaagccccacctattaaagtgcctgaggctcccaaagaagtggtccct
gaaaagaaagtacccgtggcacctcctaaaaagccagaagccccacctgctaaagtaccc
gaggtgccaaaggtcacagtccctgaaaagaaagtacctgaagtgatcccccccaaacca
gaaagtccgccccctgcagtgtatgaggagcctgaggaaattctcgtggaagaacctcca
gctgaagttgttgaagaaccagagccccctgctcctgcaaaagtgatagagccacctaag
aaacctgtcccagaaaagaaaccacctgctgtcattgccaaaaaacctgaaccaccacca
gtgaaagtgcccgaggcgcccaagaaagttgttcctgaaaagaaagtgcctcctgtggct
ccccaaaaagcagaagtcccacctgctaaagtgcctgaagtgccaaaagaagttgttccg
gaaaagaaagtagccgttcccaaaaaaccggaagccccaccagcaaaagtgccagaggtg
ccaaagaagcctgtcttagaagagaaaccagctgttcctgttcccaagaaagtggagcca
cctcctccagaagtatatgaagaacctgaggaaattgttcctgaagagaaagaacctgag
gaaattgttcctgaagagaaagaacctgaggaaattgttcctgaagagaaagaacctgag
gaaattgttcctgaagagaaagaaccaattcctgttgcagaagaggaggaaccagaagcc
cctccaccagcagcgcctgaagagccgaagattgtcccagaaaagaaagtccctgtcatc
aaaaaaccagaagctccacctcctaaagaacctgagcctgaaaagaaggttattgagaaa
ccaaaactcaaaccgaggcccccggctcctcctcctgctccacccaaggaagacgtgaag
gagaaaatatttcaacttaaagctgtttcaaagaagaaagtacctgaaaaacctgaggtt
ccagaaaaagtggagcttaaacctctgaaagcgcccggagccgaaaagaaagttcgcaaa
ttacttcctgaacctaaacctcaaccaaaggaagaagttgttctgaaaagcgttctaaga
aagaaacctgaagaagaagaagaacctaaaaaagtagaaaaagtagaaaaagttaaaaaa
cctgaagtaccagaaccacctcccaaagcagttgaagaagttgaggtacctccagccact
gttaccaaaagggaaaggaaagttcctgaaccaacgaaagtgcctgaaattaagccagca
atacctctccctgcacctgaaccaaaaccaaagcctcaaccagaagtgaaaataatcaaa
ccacctcctgtggaacctgcaccaacccccatcgctgccccagtgacagttccggtggtt
ggaaagaaagcagaagccaaagcacctaaagaggaggctgccaagccgaaaggtcctatc
aaagctgtagccaaaaagactccttcaccaatcgaagctgaaaggaaaaaattaagacca
ggaagtggaggggagaaacctcctgatgaagcccctttcacctaccagctaaaggctgtg
ccactgaagtttgtgaaagaaatccaagacattgtcttgaaagaagcagagtcaattggc
tcttctgcaatctttgaatgtttagtgtccccctccactgcagttacaagctggatgaaa
gatggaagcaacatccgtgagagcccgaagcacaggttcatcgcagatggtaaagacaga
aagctgcacatcattgacgttcagctttctgatgctggcgagtacacctgtgttttacgt
ttgggaaataaagaaaagacctccacggctaaacttgtggtagaagagattccagtgcgt
tttgtaaaaacgctagaagaggaagtcacagtggttaaaggacagccattgtacttgagc
tgtgagctaaacaaagagcgcgatgtggtctggaggaaggatgggaagattgtggtggag
aaaccaggcaagattgtgccaggtgtcatcggcctgttgcgggctctgaccatcaatgat
gccgatgactttgatgctggaacatacacggttactgtggaaaatgccaacaacctggag
tgttcatcttgtgtaaatgttgtagaagtccttagagattggctagtgaaacccatacga
gatcagcacgtgaaacccaaggcgacagctgttttcacctgtgatctagcaaaggaaact
ccaaacattaagtggttcaaaggatacgatgaaatccccacggaaccaaatgataagact
gagatactgagagatggaaatcatctttacctgaaaattaagaatgctacaccagaagat
gttgctgaatatgcaatagaaattgaagggaaaagatactctgcaaagctgacccttgga
gagcgtgaggttcaactgcttaaaccaatagaggatgttactatttatgagaaagaaagc
gcaagctttgatgcagaaatctctgaggctgacattcctggacaatggaaactgaaggga
gaacttctaaggccctcacctacttgtgaaatcaaagcagaaggtggaaaacgcttctta
actttgcataaagtcaaactggaccaagctggggaagtcctttaccaggcacttaatgca
attacaactgccattctgacagtaaaagaaatcgaacttgactttgcggtgcccctgagg
gatgtcactgttccagaaaagcgacaggctcgatttgaatgcgtcctcacccgagaggca
aatgttatatggtcaaaaggacctgatataatcaagtcatccgacaaatttgatatcatt
agcgatggaaagaaacacattcttgttatcaataattctcaatttgacgacgaaggggtc
tataccgcagaggtggaaggcaagaagacttctgcacggttatttgttacaggtgtaaga
ttgaaattcatgtcgcctcttgaagatcagacagtgaaagaaggtcagacagcaactttt
gtttgtgaactttctcatgaaaaaatgcatgtagtctggttcaaaaacgatgtcaaactc
cacacaagcagaactgtactcatgtcatctgagggcaaaactcacaaattggaaatgaga
gaagtgacactggatgatatatcccagataagagctcaagtcaaggacctgagttccaca
gcacagctaaatgtcttagaggctgatccctacttcactctgaaattacatgacaaaact
ggagtcgagaaagatgagatcattctgaagtgcgcagtgagcaaagatgtaccagtgaaa
tggttcaaagatggcgaagagattgtaccttcacccaagcattctatcaagacagatggc
ctgcaccgcatcttaaaaatcaaaaaggcagaacttaaggataaaggcgaatatgtgtgt
gactgcgggacagacacaacaaaagcaaatgttactgtggaggctcgactaataaaagtg
gaaaaacctctgcgtggagtagaattgtttgttggtgaaacagcccgctttgaaattgaa
ctttcagaaccagatgttcatggccagtggaagttaaaaggagagcctttaactgcttcc
cctgactgtgaaataattgaagatgggaagaagcatattctgatccttcataactgtcag
ctaaatatgacgggagaggtttccttccaagctgccaatgctaaatctgcagccagtcta
aaagtgaaagaattgccacttatcttcatcacacctctcagtgatgttaaagtctttgag
aaagatgaagctaagtttgagtgtgaagtatccagggagcccaaaacattccgttggctg
aaaggaacccaggaaatcataggtgatgacagaattgagcttataaaggatggcaccaag
cattcgatggtgatcaaatcagctgcttttgaagatgaagcgaagtacatgtttgaagcg
gaagataagcacacaagtggtaaactgattattgaaggaatccggctcaaattcctcacc
cctcttacggatgtaacagccaaagagagggaaagtgctgtgtttactgtggagctatcc
catgataacatccgagttaagtggttcaagaatgaccagcgcctacataccaccaggcgg
atctcaatgcaggatgaagggaagactcattcaatcacattcaaagacctctctattgat
gacacctcccaaattagagtagaagctatggggttaagttccgaagctaaactcactgtt
cttgagggagatccatattttacaggaaagcttcaagactatactggtgtagagaaagac
gaggtgattctacagtgtgaaatcagcaaaccagatgcaccagtgaaatggtttaaggat
gggaaagagatagagccgtctaaaaatgctgtcattaaggcggatggcaagaaacgcatg
ttaatcctaaagaaagccttgaaatcagatattgggcagtacacctgtgattgcgggaca
gatcagacctcaggaaagcttggcattgaggatcgggaaattaaactggtgcgacccctg
tgcagcgtggaggtgatagagacagagactgcccgcttcgagaccgaaatctctgaggag
gatatccatgccaactggaaactgaagggggaggcactactccaaacacctgagtgtgag
attaaggaagaaggcaaaactcacttccttattttgcacaactgccgcctggaccagaca
gggggggtggatttccaagctgccaatgtcaaatctagtgcacatctccgagttaaacca
cgagcaattggacttctgaggcctctaaaggatgtcacagtgactgcaggggaaacagcc
accttcgactgcgagctctcttatgaggatatcccagtggaatggtatctgaaagggaag
aagctagagcctagcgataaggtggtcgcacgttcagatggaagagttcatacacttacc
ctaagggatgtaaaattagaagatgctggggaagtccaactaagagcaaaagatttcaaa
actcaagccaacctctttgtaaaagaacccccagttgaattcactaaacctcttgaggac
cagacggtcgaagaggaggccactgcagtcttggaatgtgaagtatccagagaaaatgct
aaggtgaaatggttcaaaaatgggacggaaatcctcaaaagcaagaagtatgaaattgtc
acggatggcagggtcagaaaacttattatacacggctgtaccccagaggatattaaaaca
tatacttgtgacgctaaggattttaagacttcctgtaacctgaatgtcgtgcctcctcac
gtggaattcttaagaccactcactgatctccaagttaaagaaaaagaaatggctcggttt
gagtgtgaaatttcccgagaaaatgctaaggtccagtggtttagagatggtgctgaaatt
aaaaagggcaaaaaatacgacatcatatctaagggagcagtgcgcattcttgtcatcaac
aaatgtctgctggatgacgaagcagaatattcctgcgaagtaaggactgcgagaacttct
ggcatgctgacagtactggaggaagaagctgtctttacgaaaaatcttgcaaacattgaa
gttagtgaaacagacactataaaactggtttgtgaagtctccaagcctggagcaggagta
atttggtacaaaggtgatgaagagatcattgaaacaggaagatacgaaatagttaccgag
ggaagaaagagaatcttgatcattcagaatgctcaccttgaggatgcaggcagctacaac
tgccgactcccaagttctcgaactgatggcaaagtcaaagtacacgaacttgctgctgaa
tttatctcaaagcctcaaaaccttgagatacttgaaggagaaaaggctgagtttacctgc
acgatatcaaaggaaagttttgaagtccagtggaagagggatgatcagacccttgaatct
ggagataaatatgacattattgctgatggcaaaaagagaatcttagttgttaaagatgcc
acattacaagacatgggcgcttatgtagtcatggttggggccgccagagcagcagctcac
ttaacagtaattgaaaaactcaggatcatagttcctcttaaggacacacgtgtgaaggaa
caacaagaagttgtttttaactgtgaagtcaatactgaaggtgccaaagcaaaatggttc
agaaatgaagaagccatatttgatagttcaaaatacattattctccaaaaagacctagtc
tatacccttagaatcagaaatgcacgattagatgaccaagccaactacagtgtgtcactg
accaaccacagaggtgaaaatgttaagagtgcagccaatctaatagtagaagaggaagac
cttaggattgttgaacctcttaaagatattgaaacaatggagaagaaatctgtcacattc
tggtgcaaagtgaatcgtctcaatgtaacactgaaatggatgaaaaatggagaagaagta
cctttggacaaccgtgttttatacagaattgataaatataagcactctctaatcattaaa
gactgtggcttcccagatgaaggtgaatatactgtcattgctggccaagataaatctgtt
gccgagcttcttatcattgaagcacctacagaatttgtggaacacttggaagaccagaca
gtcactgagtttgatgatgctgtcttctcctgccagctctccagagagaaagcaaatgta
aaatggtacagaaatgggagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagat
ggaagtatacacagacttattataaaagattgcaggctggatgatgaatgtgaatatgct
tgtggagtagaggatagaaagtctcgagctagactttttgtggaagaaatccctgttgag
atcatcaggcctcctcaagatattctcgaagcccctggtgctgatgttgtcttctctgct
gagctcaacaaagataaggtggaagtccagtggctaagaaataacatgattattgttcag
ggtgataaacatcaaatgatgagtgaaggaaagatacacagactacagatttgtgacatt
aagccccgtgaccagggtgaatacagatttattgccaaagacaaagaagccagagctaag
cttgaactggcagctgcacctaaaatcaagactgctgaccaagaccttgtggttgacgtt
ggccagcctctgacaatggtggtgccgtatgatgcctaccccaaagcagaagctgagtgg
tttaaagataatgaagctttatcctcaaaaactgttgacactacagctgaacaaacttct
ttcagaattttaaaagccaagaaaggagacagaggaaggtataaaattgtgcttcagaat
aaacatggaaaagcagaaggattcatcaatttacgagttatcgatgttcctgggccagta
cgcaacttagaagtgacagaagcacttgatggtgaagtgagcctagcttgggaagagcca
ttaactgatggtggaagcaaaatcataggttatgttgttgaaagacgcgacatcaagaga
aagacctgggttctggccactgaccgcgcagacagttgtgactttaccgtcactggactg
caaaaaggaggaattgagtacctcttccgtgtaagtgcaagaaacagagtcggcactgga
gaaccagtagaaactgacaatcccgtagaagcaaggagtaaatatgatgttccaggccct
cctttgaatgtagccatcactgatgtgaacagatttggtgtctcactgacatgggaacca
ccagagtacgatggaggtgcagagatcactaactatgtcatcgaattacgggacaagact
tctatcaggtgggacaccgccatgacagtaagagctgaagacctgtctgcaactgtcact
gatgtggtggaaggacaggagtatagttttcgggtcagagcccaaaaccgaattggagtt
ggaaaaccaagtgcagccacgcctttcatcaaagtcactgatccagtcgagagaccaagt
cctcctgtcaaccttaatgcctcagaccagactcagtcatcagttcagctcacatgggag
cctcctctgaaagacggaggaagcccaatattgggctatataattgagcggtgtgaagaa
ggaaaagataattggattcgttgcaatacgaaacttgtccctaaactaacttacaaggtt
actggattgcaaaaaggaaataagtatttatatagagtatctgcagaaaatgaagctggt
gtttcagatccatctgaaattcttggtcctctaactgctgatgattcatttgttgaacca
acaatggatttaagtgcatttaaagatggtctggaagtcatcgtcccaaatcctatcacg
atcctggttccaagtacaggctatccaaggccaactgcaacctggtcttttggagataag
gtactagaagcaggagaccgtgtgaaaatgaagaccataagtgcctatgctgaacttgtc
atttctccaagtgaacgtccagacaagggcatttatacactgaaattagaaaatcctgtg
aaagcaatctctggtgaaattgatgtcaatgtaattgctcgcccaagtgcacccaaagaa
ctgaaatatggtgaggtaaccagggactcagtacatctgacttgggaaccaccagatgat
gatggaggaagtccactaactggatacctggttgaaaagcgggaagttagccggaaaaca
tggactaaagttatggactttgtgactgacctagaattcacagttcctgatcttgttcaa
ggaaaagaatatgtatttaaagtctgtgctcgtaacaagtgtggccctggagagcctgca
tatgttgatgaacctgtaaatatgtcagctcctgcaacggtacctgacccaccagagaat
gttaaatggagagatcgaactgccaagagcatcttcctaacatgggatccacctaaatat
gatggtggttcacgcatcaaaggatacatagttgaaaaatgcccacgtggttctgataaa
tgggtcgcctgtggagaaccagttgcagacacaaaaatggaagtaacaggtcttgaggaa
ggcaaatggtattcctaccgtgtgaaggccttgaacaggcagggtgccagcaaaccgagc
aaacccactgatgaaatccaggctgtggatacacaggaggctccagaaattttcctcgac
gtgaagctccttgctggtctcactgtaaaagccggaactaagattgaacttcctgccact
gtaactggaaaacctgaacctaagataacttggacaaaggctgatacgctcctgaaacag
gacaaaaggatcaccattgaaaatgttcctaaaaagtccacagtgactattgtagacagt
aaaagaagtgacactggcacatacatcatcgaggctgtgaatgtgtgtggccgagccact
gcgacagtggaagtcaacgttttagataaacctggaccaccagctgcttttgacatcaca
gatgtaaccaatgagtcatgtcttctgacatggaaccctccacgagatgatggtggatct
aaagtcacaaactatgttgtagagagaagggcaactgacagtgaagtgtggcacaagctc
tcctcgactgtcaaggatacaaatttcaaggcaaccaaattaatacccaataaagaatac
ctcttcagagttgctgcagaaaacatgtatggtgttggtgagccagttcaggccagtcca
ataacagccaaatttccatttgacccacctggacctccaactcgccttgaaccttctgat
ataactaaagatgcagtgactctcacatggtgtgaaccagatgatgatggtggcagccca
atcactggatactggcttgaaagattagaccctgatactgataagtgggttagatgcaat
aagatgccaataaaggacacaacattcagagtgaaaggtctcaccaataagaagaaatac
agattccgtgtgttggctgaaaatcttgctggacctggaaaaccaagcaggtcaactgaa
ccgatcctaataaaggatcccatagatcctccatggccccctggaaaaccaatcgtgaaa
gatgtaggcaaaacatcattaacattgaaatggacaaagccagaacacgatggaggggca
aagattgagtcttacgtcattgagatgctaaagactggaaccgaggactgggtcagagtg
gctgagggggttcccaccactgagcacaagctcccaggacttatggaagggcaggaatac
tcattccgagttagagctgtaaacaaggctggggagagtgaacccagtgagcccagtgat
cctgtgctttgccgagagaagttatatcctccatcaccgcctcgctggcttgaagttatt
aatatcacaaaaaatacagcagacctaaaatggacagttcctgagaaagatggagggtcc
cccatcactaactacatcgtggaaaaaagagatgtgaggcgaaaaggctggcaaacagtg
gacactaccgtcaaggacaccaagtgcacggtcactccactgacagaaggctctttatat
gtgttccgagttgctgcagaaaatgccatagggcaaagtgactactgtgaaattgaggac
tccgttctagccaaagacacctttaccacccctggaccaccctatgccctgacagtggtt
gatgtgactaaacgacatgttgacctgaagtgggaaccacctaaaaatgatggtggaaga
ccaattcagagatacatcattgagaagaaagaaaagctaggtactagatgggtgaaggct
ggaaagaccgcaggaccagattgtaacttcagggtaactgatgtcattgaaggaacggag
gtccagtttcaggttcgggcagaaaatgaagctggaattggtcacccaagtgaacccaca
gaaatcctatcaattgaagatccaacaggtcctccttcacctccccttgaccttcatgtg
actgatgctgggagaaagcacattgccattgcttggaaacctccagaaaaagatggtgga
agtcctatcataggataccatgttgaaatgtgtccagtaggcactgagaaatggatgcga
gtaaattctcgcccaataaaagacttgaaattcaaggttgaagaaggtgttgttcctgac
aaggagtacgttctgagagtgagagctgttaatgctgttggtgttagtgagccatctgaa
atctctgaaaatgtcgttgccaaagatccagactgcaggccaacaattgatctggagacc
catgacattgttgttattgaaggtgaaaagttaagcattcctgttcccttcagagctgtt
ccagtcccaaccgttagctggcataaagatggcaaagacgttaaagcaagtgatagatta
acaatgaagagtgatcacatctctgcacaccttgaagttcccaagagtgtccgtgcagat
gctggagtttacaccattacactggagaataagctgggctcagcaacagcctcaatcaat
gtcaaagtcataggcctacccggaccatgcaaagatattaaagcaagtgaagtgaccaag
acttcttgtaaattaacctgggaacctccagaatatgatggtggaaccccaattcttcat
tatgtgctggaacgcagagaagctggaaggagaacgtacataccagtcatgtctggtgag
aataaactgtcttggactgtaaaggacctcataccaaatagtgaatactttttccgagtt
aaagcagttaacaagattggtggaggcgaatatattgaattgaaaaatccagtcattgct
caagatccaaagcaacccccagacccacctgtagatgttgaggttcataatcctacagct
aaggcaatgactattacatggaagccacctttgtatgatggagggagcaaaataatgggt
tacattatagagaagattgctaagggtgaagacaaatggaagagatgcaatgaacacctg
gtaccagtactgacctacacagcaaagggacttgaagaaggaaaagagtaccaattccgt
gtgcgagcagagaatgctgctggtattggtgaaccttctcgggccactcctccaaccaaa
gctgtagatcctatagatgctccaaaagtcattctgcgaacaagcctagaagtgaaacga
ggtgatgaaatagcacttgatgcaactgtttctggatcaccttacccaactattacatgg
ataaaggatgagaacgttattataccagaggaaattaagaagcgaccagcaccactggct
agaaggaggaggggtgaagttcaagaagaagaaccatttttcctgcctctgactgagcgt
ttgagtattgacaacagtaaacaaggagaatctcagctacgtgttcgagattctctccga
cctgaccatggcctgtatatgatcaaagttgaaaatgaccatggtatagcaaaggctcct
tgtaccgtcagtgtgctggatactccagggccaccaatcaactttgtatttgaagatatt
agaaagaactcagtcctctgtaaatgggaaccaccgcttgatgacggtggcagtgaaatc
ataaactacactttggaaaagaaagacaagacaaaacctgactcagagtggatcattatc
acttcaacacttagacactgcaaatattcagtgacgaagttgattgaaggaaaggagtac
ctcttccgtgtaagggctgaaaataggtttgggcctggacccccttgtgtttcaaagcca
cttacagctaaagatccatttgaaccacccgatgcacccgataagcccatcgtggaagat
gttaccagtaacagtatgctagtgacatggaacgaaccaaaagataacggaagccccatc
ttgggttactggcttgaaaaacgtgaggttaacagtacacattggtctcgtgtcaacaga
aaccttctgaattctttgaaaaccaatgtggaaggcctattagaaggactcacctatgtc
ttcagagtatgtgctgaaaatgcagctggacctggaaagttcagtccaccttcagatccc
aaaacagcacgtgatccaatctctccacctgggccacctgtcccaagagtcacggataca
agctctacaactattgaactagaatgggaacccccagctttcaatggtggtagtgaaatt
attggctactttgtcgataagcagctggttggcacaaatgaatggtcacgctgcacagag
aagatgattaaggtccgtcagtacaccgtaaaacaaatccgagagggtgctgattacaaa
cttcgggtgagtgccgtcaacgctgcaggtgaaggaccacctggagaaacaggccctgtt
actgtggctgaaccacaagagccccccagtgtagaactggatgtttctgtcaaggctgga
atacaaataatggctgggaagactcttagaattccagctgtggtgactggtcgtcctgta
cctacgaaagtatggaccatagaagaaggagagctagataaagaccgtgttgtaatagag
aacgttggaaccaaatctgacctggttatcaagaatgcactgagaaaagatcatggcaga
tatgtgataacagctactaatagttgtggttccaaatctgcagcagccagggtagaagtt
tttgatgttcctggtccagttcttgacttaaaacctgttgtaacaaacagaaagatgtgt
ttgcttaactggtctgatccagaagatgatggaggaagtgaactcacgggctttattatt
gaaaggaaagatgccaagatgcatacttggagacaaccaatagagactgagagatctaaa
tgtgacatcacaggtctccttgagggggaagaatatatgttccgtgttattgccaagaac
aagtttggctgtggccctcctgttgaaataggaccaattcttgcagttgacccactaggt
cctccaacatctcctgagaggctcacatatacagaaaggacaaagtccactattaccctt
gactggaaagagcctcgcaatgatggtggcagtcccatccaaggatatatcattgaaaaa
cggcgtcacgacagacctgactttgaaagagttaaccagcgactctgcccaaccacatct
tttctggttgacaatcttgatgagcatcaaatgtatgagttccgcgtcaaagcagtcaat
gcgattggtgaaagtgaaccatccttgcctcttaatgtggtcatacaagatgatgaagca
cctccgactattaagttgcgcctggctgttcgaggagacactatcaaagttaaggcagga
gagcctgttaacatccctgcagatgtgacaggacttccgatgcctaagatcgagtgggcc
aagaatgaaacagtgattgaaaaacccactgaggcactacagataaccaaggaagaagta
tcccgaagtgaagcgaagactgaactcagcattcctaaagcagtccggggggacaaaggc
acttacacaatcactgctgccaatcgccttggctcagtgttccgaaatgttcacgttgaa
gtgtatgaccgcccatccccaccaagaaaccttgccgtaactgacattaaagctgactct
tgctacttgacatgggatgcccctctagataatggtggcagtgaaatcacccattatgtc
atagacaagcgcgatgcaagtaggaagaaagttgaatgggaagaagtcaccaacactgct
gtagacaggagatatggggtctggaaacttatccccaatggtcaatatgagttccgagtt
agggcagtgaacaaatatggaacaagtgatgagtgcaaatcagataaaacggtcattcaa
gatccttatcgccttcctggacctccaggaaaaccaaaagttctggagcgcaccaaagga
tcgatgctagtgagctggactcctcctttggacaacggtggctctccaatcactggctac
tggctggagaagagagaggagggaggggcctactggtcacgtgtcagccgagcaccgata
accaaactgggattgaaaggtgtggaatttaatgttccccgtttgattgaaggcgttaaa
taccagttcagagcaatggcaataaatgctgcaggaattggccctcccagtgaaccatca
gatccagctcttgcgagcgatcccatttacccacctgggccgccttcttgcccagaagtc
aaagataaaacaaagtcaagcatctcactggcatggaaacctccagctaaagatggtggc
agtccaatcaaagggtacattgtagaaatgcaagaagaaggtactactgactggaagaaa
gtaaatgaaccagacaaactgctaactacctgtgaatgtgtggtgcctaatctgaaagaa
ctcaggaagtacagattcagagtgaaagctgtcaacgaagccggtgaatctgaaccaagc
gatacaacaggagagatacctgccactgatattcaagaggaaccagaagttttcattgat
atcggtgcacaggattctctggtttgtaaagctggctcacagattaggattcctgctgtc
atcaagggacgcccaacgccaaaatcatcttgggaatttgatggaaaggcaaagaaggca
gtgaaggatggaattcatgatatacctgaagatgcacagctggagactgctgaaaactca
tcagtaattattattcctgagtgtaaacgctctcattcaggcaaatacagcatcacagcc
aaaaataaagcaggacagaagactgcaaactgtagagttaaagtcatggatgtaccagga
ccacccaaagatctgaaagtcagtgacatcaccaggagtagttgcaaactttcatggaag
gtgccggatgatgatggaggagacaggatcaaaggctatgttattgagaagaggactatt
gatggaaaagcctggactaaagtcaatccaaactgtggaagcaccacgtttgtagtgcct
gatctcatcgcggaacagcaatatttcttccgtgtgcgtgcagaaaaccgttttggtatt
ggggcacctgtggaaaccattcagaggaccactgctagagacccaatatatcctcctgat
ccacccattaaactcaagattggcctcataacaaagaatacagtacacctgtcatggaaa
cccccaaagaatgatgggggctcccctgtcacccattatatcgttgagtgccttgcgtgg
gaccctactgggaaaaagaaagaagcctggagacagtgcaataagcgtgatgtggaagaa
ctgcagtttaccgttgaagacctcatcgagggtggggaatatgaattcagagttaaggct
gtcaatgctgcaggagtcagcaaaccttcagccactgttggcccggtgattgtcaaagac
cagacatgtccaccgtcaattgatctaaaagaattcatggaagtcgaagaaggaactgat
gttagcattgtggccaaaattaaaggtgtgccgttccctacactaacctggtttaaagct
cctccgaagaagcctgatgacaaacagcctgttatctacgacacccatgtcaacaaactc
gtggtggatgatacttgcaccttagttattccacagtctcgaaggaatgacactggctta
tataccatcacagctgtaaataatctgggaacagcatcaaaggagatgagactgaatgtc
cttggtcgtcctggccctccagtgggacccataaagtttgaatctatttcagcagatcaa
atgacattatcttggcttccacctaaagatgatggtgggtctaagattacaaactatgta
attgagaaaagagaagctaacaggaagacatgggtacgtgtctccagtgaaccaaaagaa
tgcatgtacacaattcctaaattgctagaaggccacgaatatgtattccgcatcatggct
gagaataaatatggcattggggagcctctcgacagtgaaccagaaacagcaagaaatctt
ttctccgtccctggagcaccagataagccgacagttagcagcgtgactcgtaactccatg
acagtcaactgggaagagccagaatatgatggaggctctcctgtgacagggtactggcta
gaaatgaaagacaccacttcaaagagatggaagagagttaacagagatcctatcaaggcc
atgactttgggtgtttcttataaagtgactggtcttattgaaggttctgactaccaattc
cgggtatatgctatcaatgctgctggtgtgggcccagcaagtcttccatcagacccagtg
agagctagagatccgattgcccctcccggtcctccgtttcccaaagtgacagactggact
aaatcatctgtggatctggaatggactcccccactgaaagatggaggatccaaagtaact
ggatacatcgttgaatataaagaagaaggaaaagaagaatgggaaaagggcaaagataaa
gaagtgagaggaacaaagcttgttgtgacaggattaaaagaaggagcattctacaaattt
agagtgagagcaatcaacattgctggcatcggagaacctggagaagctacagatataatt
gaaatgaaggacagaattgttttacctgacgttcagctagatgccagtgtcagagataga
attgtggtccatgccggaggggtgattcggatcattgcctatgtgtctggaaagccacct
ccgacagtcacctggagcaagaatgaaagtgcgttaccccaagaagccaccatcgagacc
acagccattagctcatccatggtcatcaagaattgcgagaggagccaccaaggcgtctac
tctcttctcgccaaaaatgcggggggagaaagaaagaagacaatcattgttgatgtatta
gatgtgccaggtcctgttggaattccattcctagcccacaacctaaccaatgactcctgc
aaactgacatggtttactccagaagatgacggaggctctccaatcaccaactatgtcatc
gaaaagcgggaagctgaccgcagagcatggaccccagtgacatgtacagttacccgacag
aatgctactgtccagggtctaattcaaggaaaagcctactttttccgaattgcagctgaa
aatagcatcggcatgggcccatttgttgagacatcagatgaactcatcatcagagatcca
ataactgtacctgaacgtcccgaagatctggaagtcaaagaagtcactaaaaacactgtt
tcgctaacttggaatcctcctaagtatgatggtggatcagaaattattaactatgtccta
gaaagccggctcattggaactgagaagttccacaaagttacaaatgacaatttgcttagc
cgaaaatatactgtcaaaggcttaaaagaaggtgatacctatgagtaccgtgtcagtgct
gtcaatattgtcggacagggaaaaccatcattttgcaccaagccaatcacttgtaaagat
gagctggctcccccaacgcttgacctcgatttcagagataagctcatcattcgagttggt
gaatcttttgccctcaagggccgttactcaggcaagccaaagcctaaggttacttggttc
aaagatgaagctgatgtgctagaagatgatcgcactcatataaagaccactccaacaaca
attgctctagagaagatcaaagccaaaagatcggattctggcaaatactgtgtggttgtg
gagaacagcacaggctcaaggaaaggtttctgtcaagttgctgttgttgatcgtcctgga
ccaccagtaggaccagttatttttgacgaggtaaccaaagatcacatggttatctcttgg
aaaccacctttagatgatggaggaagtgaaattaccaattatattattgagaagaaggag
gtgggcaaagacgtttggatgcctgtgacatctgcaagtgctaaaccaacatgcaaagtt
tctaaactgctcgaaggaaaagattatattttccggatacatgctgaaaatctatatgga
ataagtgatcccttggtgtctgatgcaatgaaagccaaagatcgtttcagggttcctgat
gcacctgagcagccgattgttacagaagttaccaaagactcggcattagtaacttggaac
aagccacatgatggaggaaaacccatcacaaactacatcctagaaaagagggaaactatg
tctaaacggtgggctagagttaccaaagagcccattcatccatacactaaatttagggtt
cctgatcttctagaaggctgtcagtatgaattccgggtttctgcagaaaatgaaattggt
attggagatccaagtccaccatccaaaccaatctttgctaaagatccaattgctaaacca
agtccacctattaatcctgaagcagtagacacaacatgtaattcagttgatctaacttgg
cagccaccacgtcatgatggtgggagcaagattctgggttatattgttgagtaccagaaa
gttggagatgaagagtggaaaagagctaatcacactcctgagtcatgtcctgaaaccaaa
tataaagtcactggtcttcgagatggtcaaacctataagttcagagtaatagcagtaaat
aaagctggtgaatcggatccagctcatgttcctgagccagtgctcgtaaaagacagactt
gaacctcctgagttgattcttgatgccaatatggcaagagaacaacacataaaggttggt
gataccctaagacttagtgccatcatcaaaggagtgccattcccaaaagtaacttggaaa
aaagaagacagagaggctccgacaaaagcaacaattgatgttactccagttggtagcaag
cttgaaattcgtaatgctgcccatgaagatggtggaatttattccttaacagtagagaat
ccagctggttcaaaaactgtctcagtgaaagtacttgtattagataaacctgggccacct
agagacctggaagtcagtgaaattcggaaagattcttgttaccttacttggaaggaacca
ctggatgatggtggttctgttgttacaaattacgtggttgagaggagagatgttgccagt
gcccagtggtcacctctttcaactacgtcaaagaaaaagagtcacttggccaaacatctt
aatgaaggcaatcagtatctcttccgagtagctgctgagaatcagtatggacgtggtcct
tttgttgaaacacttaaacccatcaaggctctggatcctctccatcccccagggccaccg
aagaacctccaccatgtagacgttgacaagactgaagtctcccttgtttggaataagcca
gatcgtgatggtggctctccaatcactggatatttggtggaatatcaagaagagggagcc
caagactggacaaaattcaagactgtgacaaacttagagtgtgttgttactggattacaa
caaggaaagacctatagattccgtgtaaaagctgaaaatattgtgggtctcggtctccct
gacacaactattccaatagaatgtcaagaaaaactggtgcctccatctgtggagctggat
gtgaaattaattgaaggccttgtggtaaaagctggaactacagtcagattccctgccatt
ataagaggtgtacccattcctactgcaaagtggacaactgatgggagtgaaattaaaaca
gatgaacactacacagttgaaactgacaacttctcatcagtactcactattaagaactgt
ataaggagagacactggagaatatcaaatcactgtttccaatgcagctggcagcaaaaca
gtagctgtacatctcactgtccttgatgttcctggtccaccaacaggtcctattaatatt
ctggatgttacccctgaatacatgactatctcatggcaaccacctaaggatgatggagga
agccctgtaataaattatattgttgagaaacaagatacaaagaaagacacgtggggtgtt
gtctcttcaggaagcagtaagactaagctgaaaatcccacatctgcaaaagggctctgaa
tatgttttccgagtcaaagcagagaataagatgggtgttggtcctccccttgactccaca
cctactgttgctaaacataggttcagtcctccatcccctcctggtaaacccgtggttact
gacattactgaaaatgccgcaacagtgtcttggaccctgccaaaatctgacggtggcagt
ccaataactggttactatgtggaacgtcgagaagtaactggcaagtgggtgagggtcaac
aaaacacctataactgacctgaagttcggagtgactggactctatgagggaaatacatac
gagtttagagtttttgctgaaaatcttgcaggactaagcaatccatccccaagttctgac
ccattaaaagcttgccggcccatcaaaccacctggaccacctattaatcctaaactgaag
gacaagaccagagaaactgctgacttggtgtggacaaagcctctcagtgatggtggtagc
cccattctaggatatgtagtagaatgtcagaagcctggcacagcacaatggaacaggatt
aataaagatgaactcattaggcagtgtgcctttagggtacctggacttattgaaggaaat
gagtacaggttccgtataaaggcagctaatattgtgggagagggagagcccagagaacta
gcagaatctgtgatcgcaaaagacattcttcatcctccagaagtagaacttgatgttact
tgtcgtgatgtaattaccgttagagtgggtcaaacaatccacatccttgccagagttaaa
ggtaggcctgaaccagacataacttggtctaaggaaggcaaagtattggtccgagacaag
cgggttgatctaattcacgaactacctcgtgtagagttacacattaaagaagctgttaga
actgaccatggcaagtatatcatttcagctaagaacagcagcggacatgctcaaggttca
gccattgttaatgtccttgacagacctgggccttgccagaatttgaaggttaccaatgta
accaaagagaactgtacgatttcttgggaaaatccactagataacggtggctcagaaatc
acaaatttcatagtagagtatcgcaaaccaaaccagaaaggctggtcaattgttgcttcg
gatgtcactaagcgattaatcaaggccaacctcttagccaacaatgaatactatttccga
gtttgtgcagagaacaaagtgggtgttgggccaaccattgaaacaaaaactccaattctg
gctattaatcccattgatagaccaggtgagcctgaaaaccttcatatcgcagataaagga
aagacatttgtctacctaaagtggcggcggcctgattacgacggtggcagccccaatcta
tcatatcatgttgagagaaggctaaagggctctactgactgggaaagagtgcataaagga
agcattaaagatacccactacatggttgacaagtgtgttgaaaaccagatttatgagttc
agagtgcaaacaaagaacgaaggtggtgaaagtgactgggtaaatacagaggaagttgtg
gtgaaggaagacttacagaaaccagtacttgatctgaaattaagtggtgtactaactgtc
aaagcaggcgacaccattagacttgaggcaggagttagaggcaagccatttccagaagtt
tcctggaccaaggacaaagatgctacagacttaacaagatcaccaagagtcaagattgat
accggaactgagtcgtctaaattttctcttactaaagcaaagcgaagtgatggtggtaaa
tatgttattacagcaactaacacagctggcagttttgtggcctacgcaactgtcaatgtt
ttagataagcctggtcctgtaagaaatctgaaaattactgatgtgtccagtgatcgttgt
actgttcgctgggacccaccggaagatgatggcggctgtgaaatccaaaattatattcta
gaaaaatgtgagagcaagcggatggtttggtctacctattctgctactgtcttagtacct
ggtgctacagtaacacgtcttatagaaggaaatgaatatattttcagagtccgtgcagaa
aataaaataggcactgggcctccaacagaaagtaaaccagtcatcataaaaaccaaattt
gatagacctggtcgtcctgatcccccagaagttactaaagtaagcaaagaagagatgact
gtggtttggaatccaccagagtatgatggtggaaagtccatcacaggatactttttagag
aaaaaggagaaacactcagcacgatgggtccctgttaacaagagtgcgatccctgagaga
cgtatgaaagtacagaatctcctcccagggcatgaatatcagttccgagtcaaggcagaa
aatgaaattggaattggagaaccaagtttgccatcaagaccagtggtggcaaaagaccca
atagaaccacctggtccaccaaccaatttcaaagtggttgatacaaccaaaaattccata
actcttgggtggggaaaaccagtctatgatggtggagcaccaataattggatatgttgtg
gaaatgagaccaaaaatagaagatgcatcacctgatgaaggctggaaaaggtgcaatgct
gcagcacagcttgttcgcatggaattcacagttaccagtttggatgaaaaccaggaatat
gagttcagagtgtgtgcccaaaaccaagttggcattggacgtcctgcagaactaaaggat
gctattaaacctaaagaaatcctagaacctccagagattgatctggatgccagcatgaga
aagctggtcacagtgagagcaggatgccctattcgactgtttgccatagtaagagggagg
ccggcccctaaagtcacctggcgaagagtgggtattgataatgtggtcagaaaaggacaa
gtcgatctggttgacacaatggccttccttgtcatccctaattctacccgtgatgactca
ggaaaatattccttgacgcttgtgaacccggcaggagaaaaggctgtatttgtaaacgtc
agagtactagatactcctggacctgtggctgatttaaaagcttcagatgccactaaaaca
tcatgccatgtttcctggtcccctcctgaaaatgacggtgggagccaagtaacacattat
attgtggagaaacgtgaagcagaaagaaagacgtggtctacagttacctcagaagttaag
aaaacaagctaccaagtaaccaatcttgttcctgggaatgagtatttctttagagtaact
gctgtcaatgagtacggccctggtgttccaacagacatcccaaaaccagtgcttgcatca
gatcctctaagtgagccggatcccccaaggaaactagaagttactgaaatgacaaagaat
agtgctgcattagcctggttacctcccctgcgtgatggaggttctaaaattgatggctac
atcattagctatagagaagaagaccagcctgcagatcgctggacggagtactcagtggta
aaagatctcagccttgttgtcactggtctaaaggaaggaaagaaatataaatttagagta
gcagccagaaatgctgttggcgtcagtttgccaagagaagctgaaggagtgtatgaagcc
aaagaacagctgttaccaccgaagatccttatgccagagcagattactatcaaagccggg
aagaaactccgaatcgaagcccatgtgtacggaaagcctcatccagtctgtaaatggaaa
aaaggagaggatgaagtcatcacatccagccacctggcagtgcataaagcagacaattct
tcagttctgatcataaaagatgtttctaggaaggacagtggttactataacctcactgca
gagaatagttctgggtcagacacccagaaaatcaaagttatagtcatggatgcccctggg
cccccgcagcctccgtttgacattactgatatagacgccgatgcgtgctccctgtcgtgg
cacatccccctggaggatggaggcagtaacatcaccaattatatagtggagaagtgcgat
gtaagccgaggtgactgggtcactgctctagcttcagtcacaaaaacttcctgcagagtt
gggaagctgatcccaggccaggagtatatcttccgggtccgtgctgaaaatcgatttggc
atttcagagcctctcacgtcaccaaagatgcttgctaagtttccatttggtgttcctagt
gaaccaaagaatgcacgagtcaccaaagtcaacaaagactgtatctttgtgaaatgggac
agaccagacagcgatggagggagccccattaccggttacctgattgaacgcaaagaaaga
aacagtttgctctgggtgaaagctaacgatgctccagtccggtcgactgaatatccttgt
gctggccttgtcgagggtcttgagtattcgttcagaatctatgccctaaacaaagctgga
tccagcccacccagcaaaccaacagaatatgtaacagcaagaatgccagttgacccgcct
gggaaaccagaagttattgatgtttccaagaacagcgtatccctcatctgggcccgtccc
aagcatgatggaggcagcaaaattattggctatttcgtagaagcatgcaagcttcctggt
gataagtgggtacgatgcaatactgcaccccaccagattccccaggaagagtacacagct
actggcttagaggagaacgctcagtatcaatttagagcaattgccaggaccgcagtaaac
atcagccagccttctgaaccttccgatccagtgaccattgttgcagaaaatgttcctccc
aggatagaactgagtgtggctatgaagtctttgcttactgtgaaagctggaactaatgtt
tgcctagacgctactgtttttggcaaaccaatgccaacagtttcatggaagaaagatggc
acactggtaaaaccagcagaaggcataaagatggccatgaagcggaacctgtgcaccctg
gagctattcagcgtgacccggaaggactcaggagactataccattactgccgaaaacgca
agtggttccaaatcagccacgattaagcttaaagtgctagataaaccaggtcctccagca
tctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttcctgggaacctcctctt
gaagatggaggctcagaaatcaccaactatattgttgacaaacgtgaaaccagcaggccc
aactgggcacaagtctctgctactgtgcccatcaccagctgcagtgtggagaaacttata
gagggtcatgaatatcagttccgtatttgtgctgaaaataaatacggagtgggtgatcca
atcttaactgaaccagcaattgctaaaaacccatatgacccaccaggacgctgtgatcct
cctgttattagcaacataaccaaagaccacatgacagtaagctggaaaccaccagcagat
gatggtggctcgcccatcactggctatttgcttgaaaagcgggaaacccaggcagttaac
tggactaaggtcaacagaaaacctgttatagaaagaacagtaaaagcaacaggtctccaa
gaaggtactgaatacgagttccgagttaccgctataaataaagctggaccaggcaaaccc
agtgatgcatccaaagctgcttatgctcaggatcctcagtatcctcctggcccaccggct
ttccctaaagtatatgatacaacccgtagttctgtgagcctatcctggggcaagccagcc
tatgatggtggtagccctatcattggttaccttgttgaagtaaaacgagctgactctgat
aactgggtgaggtgcaatttaccacagaagctacagaaaacccgctttgaggttactggc
ctgatggaaaacgtagagtatcagttccgtgtgtttgccgttaataagattggatacagt
gaccccagtgacgtgccagacaaacactgccccaaggacatcttaattccacccgaggga
gaacttgatgctgatttgaggaaaacactgatattacgtgctggagttacaatgagactg
tatgtaccagtaaaaggacgtccacctccaaagataacttggtctaaaccaaatgtcaat
ctaagagaaaggattggactggacataaagtcaaccgactttgacactttcttgcgctgt
gaaaatgtgaacaaatatgatgcaggaaaatatatcttgaccctggagaatagcgttggt
aaaaaggaatacaccattgtagtgaaagtgcttgatactcctgggccacctgtcaatgtg
actgttaaggaaatatccaaagattctgcttatattacctgggatcctcccattgttgat
ggcggaagccccatcataaactatgtggtcgaaaaacgtgatgcagagaggaaatcctgg
tcaacagtgacaactgagtgcccaaaaacaagcttcagggtatctaacttggaggaggga
aaatcctacttcttcagggtatttgctgaaaatgagtatggcattggtgatcctggtgaa
acacgtgatgctgtcaaggcttctgaaacccctggaccagttgtggacctgaaagtgatg
tctgttactaagtcatcttgtcgcatagcctggaaaaagcctcgcactgatggtggaagt
cgaatcattggctatgtggtcgatttcctaactgaagaaaataagtggcaacgagttatg
aaatcaatgagtttacagtattctacaaaagatttgactgaagggaaggaatataccttc
agagtgagtgctgagaatgaaaatggagaaggaaccccaagtgaaatcactgttctggca
aaggatgatgttgtgcctcctgatctagatttaaaagatctacctgacttgtgctacttg
gctaaagaaaatagcaacttccgtcttaagatccccataaaaggcaagccagctccatca
gtaacctggaagaaaggagaagatcttctagcaactgacacaagagtcagtgttgagtca
tctgcagttaacacaactcttgtggtatatgactgccaaaaatctgatgctggaaaatac
acaatcacacttaagaatgttgccggcacaaaggagggaactctctctataaaagttgtt
ggcaagcctggcatccccactggaccaatcaaatttgatgaagtcacagcagaagccata
accttaaagtggggtcctccaaaggatgatggaggttctgaaatcaccaactatatccta
gagaagagagactctgtaaacaacaagtgggtgacatgtgcctcagctgtccagaagacc
acctttagggtaaccagacttcatgagggtgtggaatataccttcagggtcagtgccgaa
aataaatatggtgtaggagagggcctgaaatcggagccaattgttgctaaacatccattt
gatgtgcctgatgctccccctcctcccaacatcgtggatgtcagacacgattcagtgtct
ctaacttggactgaccccaagaaaactggtggctctccaattacagggtatcatattgaa
ttcaaggaaagaaacagccttttgtggaagagagctaacaagactcctattagaatgaaa
gacttcaaagtgacaggattaactgaaggtcttgaatatgaattccgagtaatggcaatc
aatttagcaggagtgggcaaaccaagcctgccatcagagccagttgtggcacttgatcca
attgatcctcctggcaaacctgaggttattaatgtaacaaggaattcagtgactttgatt
tggactgagccaaaatatgatggtggtcacaagctgactggatatatagtggagaagcgg
gatctaccttcaaagtcttggatgaaagcaaaccatgtcaacgtcccagactgtgccttt
actgttactgaccttgttgagggtggaaaatatgaattcagaattagagcaaagaatacg
gcaggtgctatcagtgctccatcagaaagtacaggaaccattatttgcaaggatgaatat
gaggcaccaaccattgtccttgatcccacaataaaagatgggttaacagttaaagcagag
gataccattgttttgagtgccattagcattcttggcaaaccccttccaaagtcaagttgg
tccagggcaggaaaagacattagaccatcagatatcgttcagatcacttcgaccccaaca
tcttccatgctaactatcaagtacgccactaggaaagatgctggcgaatacaccatcact
gctaccaatcctttcggaacgaaggaggaacatgtgaaagtaacagttctcgatgtacct
ggtcccccaggtcctattgaaatcagtaatgtttccgctgaaaaagtaacacttacatgg
acaccccccttggaagatggcggctcaccaattaagtcatatgttcttgaaaagagagag
accagccgactcttgtggacagtggttgctgaagacattcagtcttgcaggcatgtggct
accaaacttatccaaggaaatgagtacctgttccgggtctcagctgtaaaccactatggc
aaaggggaacctgtacagtctgaacctgtcaaaatggtagacagatttggtccccctggc
cctcctggaaaaccagaggtatcaaacgtcaccaagaacactgctactgtcagttggaaa
aggccaattgatgatggtggcagtgagatctcaggatatcatgtagaaaggagagaaaag
aaaagtttgcgatgggtgagagcaacaaagacgccagtttctgatctcagatgcaaagta
acaggactgcaagaaggaaacacttacgaattccgtgtcagtgcagaaaacaaagccgga
attggcccacccagtgatgcttcaaattttgttctaataaaagatgcagcatatcctcct
ggaccaccttcaaacgcacacatcactgatactaccaagaaatctgcttctttagcatgg
ggcaagcctcattatgatggtggacttgaaatcactggctatattgtagagcatcaaaaa
gtaggagaggaggcctggactaaagatacaacaggaacagccctcagaatcactgagttt
gttgtccctgatcttcagacaaaagaaaaatacaattttagaatcagtgccatcaatgat
gcaggtgttggggagccagcagtgatttcaaatgttgaaattgtagaacgggaaatggct
cctgattttgaactagatgctgagctccgaagaacacttgttgttagagcaggactcagt
attagaatatttgtaccaattaaaggtcgtcctgctcctgaagtaacatggaccaaagat
gatatcaaccttaaaacccgggccaatatagaaaatacagaatcatttactctactgatc
atcccagaatgtaacagatatgacactggtaaatttgtgatgaccattgaaaaccctgct
ggcaagaaaagtggctttgttaatgtcagagtcttggatacaccaggacctgttcttaac
ctgcggcctactgacatcacaaaggacagtgtcatcctgcactgggacctcccactgata
gatgggggctcacgtataacaaactatattgtggagaaacgtgaagcaacacggaaatct
tattccacagtcaccactaagtgtcataaatgcacatgtaaagttactggcttgtctgaa
ggatgtgactacttcttcagagtgatggcagaaaacgaatatggaatcggtgagccagca
gaaacaacagagcctgtcaaagcctccgaagcaccattaccaccagagagtcttaatatt
atggacataactaagagcacagtcagcctagcatggcctaaaccaaaacacgatggtggc
agtaagatcactggctatgtgattgaagcccaaagaaaaggctctgaccaatggacccac
atcacaaccgtgaaggcgttagagtgtgttgcacggaatctaactgaaggagaggaatac
accttccaagtgatggcagtgaacagtgctgggagaagtgcccctcgagagagcagacct
gtcattgtcaaggagcagacaatgcttccagaattagatctccgtggcatttaccagaaa
ttggtcatcgccagagctggtgaccacatcaaagttgagattccagtgcttggtcgacca
aagcccacagttacatggaaaaagggagatcagattcttaaacagacacagagagttaat
gtcgaaaatactgcaacttcaaccatcttaaatatcaatgaatgtgtaagaagtgatagt
gggccttatccattaacagcaaggaacattgtaggagaggttggtgatgtcatcaccatt
caagtccatgatatcccaggaccacctactggaccaatcaaatttgatgaagtttcatct
gattttgtaaccttctcttgggagccacctgagaatgatggaggagtaccaataagcaac
tatgtagtggaaatgcgacagactgacagtaccacatgggtcgagttagcaaccaccgtt
atacgtacgacctacaaagccactcgccttactaccggaatggagtatcaattccgtgta
aaagctcaaaatagatatggagttggaccaggcatcacatcagcatctgtagttgccaac
tatccatttaaggttcctgggcctcctggtaccccacaggtaactgcagtcaccaaggat
tcaatgacaattagctggcatgagcctctttctgatggaggaagccccattttaggatat
cacattgaaagaaaagaacgaaatggtattctctggcagactgtgagcaaagcattagta
ccaggcaacattttcaaatccagtggacttacagatggtgttgcttatgaattccgagtg
attgcagaaaacatggcaggcaaaagcaagccaagcaagccatctgaacctatgtttgct
ttggatcccattgacccgcctgggaaaccagttcccctcaatattactagacacacagta
acacttaagtgggctaagcctgaatatactggaggctttaaaattactggttatatagtt
gaaaagagagaccttccccatggacggtggctgaaggccaacttcagcaacattttggaa
aatgagtttacagtcagcggcctaacagaagatgctgcatatgaattccgtgtgattgcc
aaaaatgctgctggtgctactagtccaccctctgagccatcagatgctataacatgcagg
gatgatgttgaagcaccaaggataatggtggatgttaaatttaaggacacagttacatta
aaagcaggtgaagcattcaagttggaagctgatgtttcaggccgcccacctccaacaatg
gaatggaccaaagatggaaaggagcttgaaggcacaggaaaattagaaataaaaactgca
gatttttctacaaatctggtaaacaaggattcaacgagaagagacagtggggcttatacc
ctaacagcaactaatcccggtggttttgccaaacacattttcaatgtcaaagttctcgat
aggccaggcccacctgaaggacctttggctgtgtctgaagtgacatcagaaaagtgtgta
ttgtcgtgtactccactgatgatgagtgccaaaatgatcactacgtgtacagaaacgtga
aacagcagactagcatggacaaatgtagcctcagacgtccaaataacaaaactaaaggtc
actaaacttttgaaaggcaatgaatacatattccgtgtcatggctgtaaataaatatgga
gttggtgagccactggaatcagagcccatgcttgcagtaaatccttacggaccccctgat
ccacccaaaaaccctgaagttacagctattactaaagattcaatggttgtctgctgggac
catcctgactctgatggtggaagtgaaatcaccaattatattgtggaacggcgagataaa
gctgggcaacgctgggtgaaatgcaacaaaagaacgcttactgatttaagatataaagtg
tctggactgacagaaggacatgaatatgagttcaggattatggctgaaaatgctgctgga
attagtgcacccagtgcaaccagtccattttataaagcttgtgatgctgtgtttaaaccc
ggcccaccaggtaatccacgtgttctagatacaagcagatcgtccatttcaattgcttgg
aataaacctatctacgatggtggttcagaaatcactgggtatatggttgagattgccctg
ccagaggaagatgaatggcagattgtcactccaccatctgggctcaaggcaacttcttat
accatcaccaacctcatagagaatcaggaatataaaatccgcatctatgccatgaattct
gaaggaattggggaacctgcacttgttcctggcactccaaaggctgaagaaaggatgcta
cctccagagattgaactggatgctgacctgcgtaaagttgttactataagagcctgttgt
accctgagactgtttgttccaatcaaaggaaggcctgctcctgaggtgaagtggacacgg
gaacatggagaatctttagataaagctagcattgaatccacaagctcttacactcttctt
attgttggaaatgtaaacagattcgacagtggcaaatacatactaactgtagaaaatagc
tcaggcagcaagtctgcatttgtcaatgttagagtactagataccccagggcctccacaa
gacctgaagataaaggagatcactaagacatctgttacattgacatgggagcctcctctc
atcgatggaggttcaaaaataaagaactatattgttgaaaagcgggaatcaacaagaaaa
gcttattcaaccgttgcaaccaattgccacaagacctcctggaagatagaccagcttcaa
gaaggctgtagttactatttcagagtccttgctgaaaatgaatatggcattggcctacct
gctgaaactgcagaatctgttaaagcatcagaacgacctcttcctccaggaaaaataact
ttgattgatgtcacaagaaacagcgtgtcgctgtcttgggagaaaccagagcatgatgga
ggcagccgaattctaggctacattgttgagatgcagagcaaaggcagtgacaaatgggcc
acatgtgccacagtcaaagtcactgaagccactataactggattaattcagggtgaagaa
tactctttccgtgtttcagcccaaaatgaaaagggtatcagtgatcctagacaactgagt
gtgccagtaattgccaaagaccttgtcattccaccagccttcaaactcctgttcaacact
ttcactgtactggcaggtgaagacctaaaagttgatgttccattcattggacgtccggcc
ccagctgtaacctggcataaagatgatgtaccactgaagcagacaactagggtaaatgca
gagagcacagaaaataattcactgctgacaataaaggaagcctgccgggaagatgttggc
cattatgtagtcaaactgactaactcagctggtgaagctactgaaacccttaatgttatt
gttcttgacaaaccagggcctccaactggaccagttaaaatggatgaagtgacagctgac
agtattactatttcctggagcccaccaaagtatgatggtggaagttctatcaataattac
attgtagagaaacgggacacttctacaactatctggcaaattgtgtcagccactgttgca
aggacaacaataaaggcttgcagattaaagactggatgtgaatatcagtttagaattgca
gctgaaaacagatatggaaagagtacatatctcacttcggagcctattgtagcccagtat
ccattcaaagttcctggtcctccaggcacaccatttgtaacgctctcctccaaggacagc
atggaagtacaatggaacgagccagtcagtgacggaggcagcaaagtcattggctatcat
ctagaaagaaaggaaagaaatagcattctttggattaagttgaacaaaacacctattcct
caaaccaagtttaaaacaactggccttgaagaaggcattgaatatgaatttagagtctct
gctgagaacatagtgggcattggcaagccaagtaaagggtcagaatgctatgtagctcgt
gacccttgtgacccaccagggcggccagaggcaatcattgtcacaaggaattctgtgact
cttcagtggaagaaacccacctatgatggtggaagcaagatcaccggttatattgttgag
aagaaagaactacctgagggccgctggatgaaagccagtttcacaaatgtcattgacact
cactttgaagtaactggcctagttgaagatcacagatatgagttccgggttatagctcga
aatgctgcaggagtgtttagtgagccttcagaaagcacgggagcaataacagtaagagat
gaggtagatccaccacgaataagtatggatccaaaattcaaagacacagttgtacttcat
gctggtgaatcattcaagattgatgcagatatttatggcaaaccaataccaaccattcag
tggataaaaggtgatcgtgagctttcaaacacagctagattagaaataaaaagcactgat
tttgccaccagtctcagtgtaaaagatgcaatacgtgttgacagtggaaattacatattg
aaggccaaaaatgttgcaggagagagatcagttactgtgaatgtcaaagttcttgataga
ccagggccacctgaaggacctgttgctatatcaggagttacagcagaaaaatgcttgtta
gcttggaaacccccactacaagatggtgggagtgatatcataaattatattgtagaaagg
agagaaaccagccgcttagtttggactgtggtggatgccagtgtgcagactctcagctgc
aaagttactaaacttcttgaaggcaatgaatatattttccgtataatggctgtaaacaaa
tacggtgttggtgaacctcttgaatctgaatcagtaattgccaagaatccatttgttgtg
ccagatgcaccaaaggctccagaagtcacaacagtgaccaaggactcaatgattgttgta
tgggaaaggccagcatctgatggtggcagtgaaatacttggatatgttcttgaaaaacgg
gataaagagggcattagatggacaagatgccacaaacgtttgattggagagttgcgctta
agagtaactggactcatagaaaatcacaattatgaattcagagtctcagccgagaatgct
gctggacttagtgaaccaagcccaccttctgcttaccaaaaggcttgtgatcctatttac
aaaccagggcctccaaataaccccaaagtcatagatattaccagatcctcagttttcctc
tcttggagcaaaccaatatatgacggtggctgtgaaatccaaggatatattgttgaaaaa
tgtgatgtcagtgttggtgaatggacaatgtgcactccaccaactggaatcagtaaaaca
aatatagaagtagagaagctgttggaaaagcatgagtacaacttccgtatctgtgctgtt
aataaagctggagttggagaacatgctgatgtccctggacctataatagtcgaagaaaaa
ttggaagcaccagacattgatcttgatctagaactaaggaaaattataaatataagggca
ggtggctctttaaggttattcgttcctattaaaggtcgtcctacaccagaagttaaatgg
ggaaaagtggatggtgaaatccgagatgcagctataattgatgtcactagcagtttcacc
tctcttgttcttgataatgtcaaccgatatgacagtggaaaatatactctcacattagaa
aacagcagtggaacaaagtctgcctttgttactgtgagagtcctggatacaccaagtcca
cctgttaacctgaaagtcacagatatcaccaaagactcagtatcaattacatgggaacct
cctttgttggatggaggatccaaaatcaaaaattacatcgttgaaaaacgtgaagccaca
agaaaatcatatgctgctgttgtaacaaattgccataagaattcttggaaaatagaggaa
ctccaagaaggttgcagttattactttagagtcatagctgagaacgagtatggtatgggt
ctgcctgctcacactgctgatccaatcaaggtggccgaagtcccacaacctccagggaaa
ataaccgtggatgacgtcaccagaaacagtgtctccctgagttggacaaagcctgaacat
gatggtggcagtaaaatcattcagtatattgtggaaatgcaagctaagcacagtgataaa
tggtcagagtgtgctcgggtaaaatcccttgaagcagtaattaccaacctaactcaggga
gaagaatatctttttagagttgttgctgtaaatgaaaagggaagaagtgatcctaggtct
cttgcagttccaatagttgccaaagatctggtcattgaaccagatgtaagacctgcattc
aacagctacagtgtacaggttggccaagatttgaaaatagaagtgccaatttctggacgt
cctaagccaacaattacctggactaaagatggtctcccactgaagcagaccacaagaatc
aacgttactgattcaactgacctcactgtactcagcattaaagaaactcacaaggatgat
ggtggacagtatggaatcacagttgccaatgttgttggccagaaaacagcttccattgaa
attataactctagacaagcctgatcctccaaaaggacctgttaaatttgatgaagtcagt
gctgaaagtattacattatcttggaaccctccattatatacaggaggctgccaaatcacc
aactacatcgttcagaaaagagatacaaccaccacaatatgggatactgtttctgctact
gttgccagaactactctcaaagtgaccaaactgaaaactggtacagaatatcaattcaga
atatttgctgaaaacagatatggacaaagctttgccttggagtctgatgcaattgtagct
caatatccctacaaagaaccaggtcctccaggtacaccatttgtcacagccatttccaag
gattccatggtcatacagtggcatgagccaatcaataatggtggaagcccagtcataggt
taccaccttgagagaaaagaaagaaatagtattttgtggacaaaagtcaacaaaaccatt
attcatgacacccagtttaaagcactcaatcttgaagaaggcattgaatatgaattcaga
gtttatgctgaaaatattgttggtgtaggcaaagcaagcaagaattctgaatgttatgta
gccagagatccctgtgacccaccaggaaccccagaagcaataatggttaaaagaaatgaa
atcactttacagtggaccaaacctgaatatgatggcggaagtatgattacaggctacatt
gtagagaaacgtgacttgcctgagggtcgctggatgaaagccagcttcacaaatgtcatt
gaaactcaatttactgtatctggccttactgaagatcaaagatatgaattcagagtcatt
gcgaagaatgcagctggtacaataagtaagccctctgacagtactggaccaataactgcc
aaggatgaggttgaactcccaagaatttcaatggatccaaaattcagagacacaattgtg
gtaaatgctggagaaacattcaagcttgaggctgatgtccatggaaagcccctgcctacc
attgaatggttaagaggagataaagaaattgaagaatctgctagatgtgaaataaagaac
acagatttcaaggctttacttattataaaagatgccattagaattgatggcggacagtat
attttaagagcttccaatgttgcgggttccaaatcattcccagtaaatgtaaaagtgtta
gatagaccaggacctccagaagggccagtccaggttaccggagtcacttctgaaaaatgc
actttaacttggtctctaccacttcaagatggtggcagtgacatttctcactatgttgtt
gaaaagcgagaaaccagccggcttacctggactgttgtgtcttcagaagttgtgaccaat
tctctgaaagtcaccaaactcttagaagggaatgaatatattttccgcataatggctgtc
aacaaatatggtgttggagagcctttagaatctgcaccagtactaatgaaaaacccattt
gtgccacctggaccaccaaaaagcttggaagtcacaaacattgccacggactccatgacc
gtctgctggaaccgtccagatagtgatggtggaagtgagattattggttacattgtagag
aaaagagacaggagtggaattaggtggattaaatgtaataaacgtcgcattactgatttg
cgtctaagagtcacaggattaacagaagatcatgagtatgaattcagagtgtctgcagaa
aatgccgctggagttggagaaccaagtccagctacagtttattataaagcatgtgatcct
gtgttcaaacctggcccacccatcaatgcacacattgtagacaccactaaaaattcagtt
acccttgcctggggtaaacccatctatgatggtggcagtgagatcctgggatacatagta
gaaatctgtaaagcagatgaagaagaatggcaaatagtcactccacagactggcctgaga
gccactagatttgaaatttccaaactcattgaacaccaagagtataaaatacgtgtttgt
gccctcaataaagttggtttaggtgaagctgcatcaattcctggtactgtgaaaccagaa
gataaacttgaagcacctgaacttgaccttgactctgaattaaggaaaggaatagttgta
agagctggtggatctgccagaattcacattccattcaaaggtcgaccaacacctgagatc
acttggtctcgagaagaaggtgaattcacagataaggtccaaattgaaaaaggattaaac
tatacccaactatcaatagataactgtgatagaaatgatgctggaaaatacactctcaag
ctggaaaacagcagtggaaccaaatctgcttttgtaaccgtgaaagttcttgacactcca
ggaccaccacagaatttggcagtcaaggaagtgaaaaaagattctgtctttctggtatgg
gaaccacccatcattgatgggggtgcaaagatcaagaactatgttattgataaacgtgag
tcaaccagaaaagcatatgctaatgtaagtaacaaatgtaacaaaacgagctttaaagtt
gaaaatcttacagaaggagctatttattactttagagtcatggctgaaaatgaatttgga
gttggtgttccagtggaaactgttgatgccgtgaaagctgcagaacctccttccccacca
gggaaggttacactcactgatgtgtcccagacaagtgcatcacttatgtgggagaaacct
gaacatgatggcggtagcagaatcctggggtatgttgttgaaatgcaacccaaaggaact
gaaaaatggagtgttgtagctgaatccaaagtctgcaatgcagttgttactggtctgagt
tctggacaagaatatcagttccgtatcaaggcttacaatgagaaaggcaaaagcgatcca
agagtgcttggtgttccggtcatagccaaggacttgactatacagcctagttttaagtta
ccatttaacacatatagtgtccaagctggagaagatcttaaaattgaaattccagttata
ggccgaccaagacctaaaatttcttgggtcaaagatggcgagcctcttaaacagacaaca
agagtaaatgttgaagaaacatctactgcaactattttgcacattaaagaaagtaacaaa
gatgactttggaaaatacagcgtaacagcaacaaacagtgcaggcgcagcaacagaaaat
ctcagcattatcattttggaaaagcctggacctccagttggaccagttcggttcgatgaa
gttagtgcagactttgtggtcatatcttgggaacctccagtttatactggtggctgtcag
ataagcaactacattgtagagaagagagatacaactaccaccacttggcacatggtatca
gcaacagttgcaagaacaacaattaaaataaccaaactcaaaacaggcactgaataccag
tttagaatttttgctgaaaacaggtatggaaaaagtaaccctctggattctaaaccggtt
attgtacaatatccatttaaagaacctggaccacctggaactccttttgtgacatcggtc
tcaaaagatcaaatgcttgttcaatggcatgagccagttaatgatggaggtagcaaagtt
attggctaccatcttgaacagaaagaaaagaacagcattttatgggtcaagttaaataag
actcccattcaagacaccaagttcaaaacaactgggcttgatgaaggccttgagtatgag
ttcaaagtttctgctgaaaatatcgttggcatcggtaagcctagcaaagtgtctgaatgc
tttgttgctcgtgatccatgtgacccacctggtcgccctgaagccattgttattacaaga
cacaatgttacactgaaatggaagaaaccagcctatgatggtggtagcaaaataacaggt
tatgttgtagaaaagaaagatctacctgatggccgctggatgaaagccagctttactaac
gtattagaaactgaatttacagtgagtggacttgtagaaaaccaaagatacgaatttaga
gtaattgcaagaaatgcagctggaaactttagtgaaccatctgaaagtaccggtgccatt
actgcaagagatgagattgatgcaccaaatgcctcaatggatccaaaatacaaagatgtc
atcactgttcatgcaggagagacttttgttcttgaagccgatatccacggcaaacctata
cctgatattgtttggtcaaaagacggaaaagagcttgaagaaacagctgctaggatggaa
attaaatctactatccagaaaacaactcttgttgtcaaagactgtatacggactgatgga
ggacaatatattttaaaactgagtaatgttggtggtacaaagtctataccaatcactgta
aaggtacttgacaggccaggacctcctgaagggcctctaaaagtctcaggagttactgct
gaaaaatgttacctggcatggaacccacctttgcaagatggcggtgcaaatatttcacat
tacatcattgaaaagagagagacaagcagactctcctggacccaagtttcatctgaggta
ccggccctaaactacaaagtcactaaacttcttcctagtaatgagtacattttccgtgtc
atggctgtgaataagtatggaattggagagcccctggaatctgaacctgttatagcctgt
aatccttataagccaccaggtcctccttcaacacctgaagtctcagcaatcgccaaagat
tctatggtagtaacatgggcacgtccaatagatgacggaggtgctgaaattgaaggctac
gtgcttgaaaaacgagataaagaaggcattagatggaccaagtgcaacaagaaaacacta
acagatcttagattcagggtaaccggccttactgaaggccattcctatgaattcagagtt
gctgctgaaaatgcagctggtgtgggtgaacctagcgagccatctgttttctaccgtgca
tgcgatgccttgtatccaccaggtccaccaagcaatccaaaagtgacagacacttccaga
tcttctgtgtctctggcatggaataagccaatttatgatggtggtacacctgttaaaggc
tatgttgttgaggtcaaagaagctgctgctgatgaatggacaacttgcactccaccaaca
ggactacaaggaaaacagttcacagtgaccaagcttaaagaaaatactgaatataacttc
cgtatttgtgccatcaattctgaaggtgtaggtgaacctgcaactatacctggttcagtt
gttgctcaggaaaggatagagccaccagaaatagaacttgatgctgatctcagaaaggtg
gtcattctgcgtgcaagtgctactctgcgcttatttgtcactatcaaaggtagaccagaa
cctgaagttaaatgggaaaaggctgaaggcattctcactgacagggcccagattgaggtg
accagctcatatacaatgttggtgattgacaatgttaccagatttgatagtggtcggtat
aatctgacattagaaaataacagtggctccaaaacagcttttgttaatgtcagagttctt
gactcaccaagtgcccctgtgaatttgactgtaagagaagtgaagaaagactcagtgaca
ctctcttgggaaccaccacttattgacggtggagcaaagattacaaactacattgttgaa
aaacgagaaactacaagaaaagcatatgctactgttacaaacaattgcactaaaaatagt
tttaaaattgaaaatctacaagaaggatgttcttactacttccgagtcttggcttccaat
gaatatggggtcggtttaccagctgaaacaactgaacctgttaaagtgtctgaaccaccc
ctcccacctggaagagtaactcttgttgatgtgactcgtaatacagctaccattaagtgg
gagaaaccagaaaatgatggtggcagcaaaattactggttatgtagttgaaatgcaaact
aaaggaagtgaaaaatggagcacttgcacacaagttaagactctagaagcaactatatct
ggtctaactgcaggggaagagtatgtcttcagggtagctgcagttaatgaaaaaggaaga
agtgatcctagacaacttggagtgccagtaattgcaagggatattgaaataaagccttca
gttgagcttcctttcaacactttcagtgtaaaggctagagaccaacttaagattgatgtg
ccatttaaaggaagacctcaagccaccgttagctggaagaaggatggtcagactcttaaa
gagacaactagggtcaatgtttcttcttcaaagactgtaacatccctatctattaaggag
gcttcaagggaagatgttggaacttatgaattatgtgtttcaaacagtgctggatctaca
acagttcatattactgtaattatccttgacagaccaggacctccaggacctatacgtatt
gatgaggttagctgtgacaatgtaaccatttcttggaatcctccagaatatgatggtggc
tgcgaaattagcaattacattgttgaaaagagagaaaccacttctacaacatggcaagta
gtttcacaggcagttgcaagaacatccattaaaatagttcgtctgacaacaggaagtgag
tatcagttccgtgtttgtgcagaaaaccgctatggaaagagttcctacagtgaatcttca
gctgttgttgcagagtatccattcagtcccccaggacctcctggtactcctaaagttgtg
catgccacgaaatctaccatgattgtaagctggcaagtgccagttaatgatgggggaagt
caagtaattggctatcaccttgagtataaagaaagaagtagcattctgtggtccaaagca
aataaaatcctcattgctgatactcaaatgaaagtcaccggccttgatgaaggactgatg
tatgagtatcgtgtttatgctgagaatattgctggaatcggtaaatgtagtaaatcttgt
gaaccagtgcctgcaagagatccttgtgatcctcctggacaacctgaagttacaaatatc
acgagaaaatcagtgtcacttaaatggtctaaaccacattatgatggtggagctaagatc
acaggctacattattgaacgtagagaactaccagatggccggtggctgaagtgcaatttt
actaccatacaagaaacttactttgaagtaactgaacttactgaagatcagcgttatgaa
ttccgggtttttgcaaggaatgctgctgactcaattagtgaaccatctgaatccactgga
cctattacagttaaagatgatgtcgaagctccaagaattatgatggatgtcaagttccga
gatgttattgtcatcaaagctggagagatccttaagattaatgcagacattgcaggacga
cctctgccagtagtttcctgggccaaagacggtatagaaattgaagaaagagcaagaaca
gaaattgtctcaacagactataatactttgttaacagttaaagactgtataagacgagac
actgggcagtatgtactaacactgaagaatgttgcaggaactcggtctatggcaattaat
tgcaaggtccttgataagcctggcccaccagcaggaccacttgaaataaatggccttact
gctgagaaatgctctctttcctggggacctccccaagaaaatggtggtgcagatatcgac
tattacatagtagagaaacgtgaaacaagccatcttgcatggacaatatgtgaaggggag
ttaagaacaacatcttgtaaggtaaccaagctactcaaaggtaatgaatacatatttaga
gtaactggtgttaataaatatggtgttggtgagccccttgagagtgtggctgtaaaggca
ctggatccatttacagttccgagtccgcccacctctttggaaattacatctgtgaccaaa
gacttcatgacactttgctggtccagacctgaaagtgatggaggcagtgacatctctgga
tacataattgaaaggcgagagaaaaatagcctacgatgggtgcgtgtaaacaaaaagcca
gtttatgatctcagagtgaaatcaataggacttcgggaaggatgtgaatatgagtatcgg
gtttatgcagaaaatgctgctggcctaagccttccaagtgaaacctctccgttaattcgg
gcagaagatccagtgttcttaccatctcctccatccaaacccaaaatcgtggactcaggc
aagacaaatataactatcggctgggttaagcccttgtttgatggtgggaccccaataact
ggatatactgtagaatacaaaacatctgatgaaactgactggacaactgccattcagagc
ttaaaaggtacagaatatacagtaagtggactaacaacaggagccgaatatgttttcaga
gtgagatctatcaataaggttggtgctagtgatcccagtgacagcactgatcctcagata
gcaaaggaaagagaagaagaacctgtctttgatcttgacactgaaatgaggaagaccttg
attgtcaaggccggtgcttcatttaccatgactgtgcctttccgaggaagaccagtaccc
actgtcttgtggagtaagccagacactgatctccacactagagcttacattgattccaca
gactgtcagacatcacttactattgaaaatgccaacagaaatgactctgggaagtacaca
ttgacaattcagaatattttgagcgctgcttcactgactttagttgtcaaagttttagat
tccccgggtcctccaaccagtattagggtacaagatgtaaccaaagagtctgcagtggtt
tcctgggatgttcctgaaaatgatggtggagcaccagtgaagaattaccacatagaaaaa
cgtgaggccagtaagaaagcatgggtctctgtgaccaacagctgtcatcgcctctcctac
aaagttaccaacttacaagaaggagctgtttattatttcagagtctctggagaaaatgaa
tatggtgttggtgtaccagctgaaacaaaggaaggagtaaaaataacagaaaaaccaagc
ccacctgaaaaacttggagtgacaagtgtgtccaaagacagtgtttccctgacgtggttg
aaaccagaacatgatggtggaagcagaattatacattatgtcgttgaagccctagaaaaa
ggacagaaaaactgggttaagtgtgcagtggtaaaggcaacccatcatgttgtttctggt
ctgagggagaatcatgaatactttttccgggtatttgctgaaaatcaagctggtctgagt
gacccaagagagcttctgcttcctgttcttgttaaggagcaactggaaccacctgaaatt
gatatgaagaatttcccaagtcacactgtatatgttagagctggttcaaaccttaaagtt
gacattccaatttctggaaaaccactgcccaaagtgaccttatcaagagatggtgtccca
ttgaaagccactatgagatttaatactgaaattactgctgagaacctcaccattaatctc
aaagaaagtgttattgctgatgctggaaaatatgagatcactgctgccaactccagtgga
acaaccagaactttccttaacatcatcgtgttagacaggcctggtcctccaactggccct
gttgttattagtgacataactgaagagagtgtgacgctcaaatgggagccacctaagtat
gatggtggaagtcaagttaccaattacattgtactcaagagagaaacaagtaccacagta
tggactgaagtgtctgcaacaatcgcaagaaatacgattaaagtcatgaaactgaccaca
ggagaagaataccaattccgtatcaaggcagaaaaccgctttggcatcagtgatcatata
gattcagcttgtgtgactgtcaaattaccatatacaacacctggaccaccatctacacca
tgggttactaatgttactagagaaagcatcacggtgggctggcatgaaccagtgtccaat
ggaggcagtgcagtcataggctatcacttagaaatgaaagacagaaacagtattttatgg
caaaaagtcaacaaaatggtcatccgcacaactcacttcaaagtcactacaatcagtgct
ggacttatttatgaattcagggtgcgtgcagaaaatgctgctggtgttggaaaactcagc
catccttctgaaccagtcctggccattgatgcctgtgaacccccgagaaatgttcgtgtc
actgatatttcaaagaactctgccagcctttcatggcaacaaccagcttttgacggagga
agcaagattacaggttacattgttgagagacgggaccttccagatggcagatggactaag
gccagcttcaccaatgttatcgagacgcaattcattgtatctggcttgactcagaattcc
cagtatgaattccgtgtctttgctaggaatgctgttggttccattagcaatccctctgag
attgtaggccccattacatgcatcgattcttatggtgcacctgtaattgatttgcctcta
gaatatatagaagttgtcaaatacagagcaggcacatccgtgaaactcagagctggcatt
tctggcaaacctgatcctacaattgagtggtataaagataataaagagttacaaaccaat
gcactggtgtgtgtcgaaaataccactgaccttgcatctatactcatcaaagatgccaat
cgccttaatagtggaagctatgaattaaaactaaggaatgccatgggctcagcctcagct
accatcagagtacagatccttgacaaaccagggcctccaggtggaccaattgaatttaag
accgttactgctgaaaagataacccttttctggcggcctccaacagatgatggtggtgca
aaaatcactcactacattgtggaaaagcgtgagacaagccgtgtagtgtggtctatggtg
tctgaaaatttggaagagtgcatcattacaaccaccaaaattatcaaaggaaatgaatac
gtcttccgcgttcgagctgtgaacaaatacggagttggcgagccactggaatctgatcca
gttatagcaaggaatgcatttgttacacctggaccaccaagcatgccagaggtgacaaag
ataaccaagaattcaatgaccgttatctggaacagaccagttgtagatggtggcagtgaa
gtcagtggttatttgctagaaaaacgagacaagaagagtctaggatggtttaaagtactt
aaggagactatccgtgacaccagacaaaaagtaacaggactcacagaaaacagtgaatat
caataccgagtttgtgctgtaaatgctgctggcctgggtccattttctgaaccatctgac
ttttacaaagctgctgatcctattgatcctccaggcccaccagctaagataagaatcacc
gattcaactaaatcatccatcactcttggctggagtaaacctgtctacgatggaggcagt
cctgttactgggtacactgtcgagatgaaacaaggagaggaagatgaatggactattgtc
tctaccaaaggagaggtcagaactacagaatatgtggtatctaatctgaaacctggaatc
aattactacttcaaggtatctgcagtaaactgtgctggacaaggagaacctatagaaatg
gctgaacctgcacaagctaaagatatacttgaggaaccagagatcgacctagatgtggct
ctcagaacctctattatagctaaagctggtgaagatgtgcaagtgttgattccctttaaa
ggtagacctccacctactgtcatgtggagaaaagatgagaagaatctcagcagtgatacc
agatacagcattcaaaacactgatttatcttcattactcattattcctcaagttactcgc
aatgatacaggaaaatatattctcacgatagaaaatggagttggccaaccaaagtcttca
actgtgactgttaaagtgctggatacaccagcagcctgccagaaactacacctcaaacat
gtttctagaggtacagtcactttgttctgggagcctcctctcattgatggagggtctccc
ataataaattatgtcattgaaaagagagatgccaccaagagaacatggtctgtcgtgtca
cacaaatgttccagtacatcctttaaggtgacagatttgtcagagaaaattccattcttc
ttcagagttcttgcagaaaatgaaatgggaatcggggagccctgtgatactacagagccg
gtgaaggctgctgaagtaccagctcctatacgagatctctcgatgaaagattcaacaaag
acatctgttaccctgaactggaccaaacctgactttgatggtggtagcatcatcacagaa
tatgtggtggaaaggaaaaatataaacgaacaaacatggtcatatgcaggtataactaag
acgtgtgaaattgaagttggccaacttaaggaacagtcagtcctggaattcagagtgttt
gccaaaaatgagaaaggactaagtgatgctgtcacaattgggccaattacagtgaaagag
cttgtcattacacctgaggtcgacctgtcggaaattcctggggcacaagtctctgtgaga
attgggcacaatgtacatcttgagttaccttataaaggaaaacccaaaccatctatcagt
tggctgaaagacggtttgccattgaaagaaagtgaacatgtccgtttcagtaaaactgaa
aacaaaattactttgaatatcaagaacgtccggaaggagcatggagggaaatacaccatt
attcttgataacgcagtttgtagaaacgtatttcccattacaatcatcacacttggccca
ccctcaaagcccaaagggcctattcgatttgatgaaatcaaggctgacagtgtcatcatg
tcctgggatgtgcctgaagatgatggaggaggagaaattacttgttacagcattgaaaag
cgggaagcttcacaaactaactggaagatggtgtgttcaagtgttgccaggacaactttc
aaagttcctaatctagtcaaagatgctgaataccagtttagagttagggcagaaaacaga
tacggagtcagccagccacttgtctcaaatattattttggcaaagcaccagttcaggatt
cctggccccccaggaaagccagttgtatacaatgtgacttctgatggtatgtcactcact
tgggatgctccagtgtatgacggcggttcagaagttacaggattccatgttgaaaagaaa
gaaagaaatagtatcctctggcaaagagttaatatatcatcaatatctggaagagaatat
agagtcactggactaatagaaggcctggattaccagttccgtgtatatgctgaaaattct
gctggcctaagctcacctagtgacccaagtaaatttacactagctgtttctccagtagac
ccacctggcattcctgactacattgatgttacccgggaaaccatcacactgaaatggaac
ccaccattgcatgatggaggcagtaagattgtggcctacagcattgagaaacggcaaggg
gatgatcgctgggttagatgcaactttactgatgtcagtgaatgtcagtacacagttaca
ggacttagtcctggggatcgatatgaattcagaataattgcaagaaatgctgttgggact
ataagcccaccctcacagtcttcaggcattattatgacaagagatgaaaatgttccacca
atagtagaatttggccctgagtatttcgacggcatcattattaagtctggagacagcctt
agaattaaagctttcgtaaaaggacggccagtacctcgagtaacttggttcaaagatgga
gtagaaattgaaaagaggatgaatatggaaataactgatgtccttggatccaccagcctc
tttgttagagatgctactcgggaccatcgtggtgtatatacagttgaagccaaaaatgct
tctggctccacaaaagcagacattacagtaaaagtacaagatacaccaggaaaagtagtt
ggaccaataagatttaccaatattactggcgagaagatgacactgtggtgggatgctcca
cttaatgacggctgtgctcctgtaactcactatatcattgaaaaacgggagaccagcaga
ctttcttgggcactaattgaagataaatgtgaagcccacagttacacggccattaaacta
ataaatggcaatgaataccaattccgtatttctgcagttaataagtttggtgttggcagg
ccacttgattctgacccagtggttgctcaaatacaatacactgttcctgatgcccctggc
attccggaacctagtaatgtaacaggcaatagcattaccctcacatgggctaggccagaa
tcagacggtggcaatgaaattcaacattatatcctggaaagaagagaaaagaaaagcacg
cgatgggtaaaagtgatcagcaaacggccaatctctgaaacacgattcaaagtcaccggc
ctgacagaaggcaatgaatacgaattccacgttatggctgaaaatgctgcaggagtagga
cctgcaagtggtatctcaagactaattaaatgtagagagccagtcagcccaccaagtgct
cccactgtggtcaaagtgacagacacatcaaagacaacggtgagcttagaatggtccaag
ccagtatttgatggcggcatggaaataattgggtatattattgaaatgtgcaaagctgac
ttaggagactggcacaaggtgaatgcagaggcatgtgtgaaaacaagatatactgtcacc
gatttacaagcaggtgaagaatacaaattccgggttagtgctgtcaatggtgctggaaaa
ggagacagctgtgaagtgactggcacaatcaaagcagttgaccgattaacagcgcctgag
ttagacattgatgcaaacttcaagcagactcacattgttagagctggggccagtattcgt
ctctttattgcctatcaggggagacctgttcctacagctgtgtggagcaaaccagactct
aaccttaacattcgcgctgacatccatacaacagattccttcagcaccctcactgtggaa
aactgcaacagaaatgatgctgggaaatatacccttactgtagaaaacaacagtggtagt
aagtcaatcacatttaccgtaaaagtgctagactctccaggcccacctggccctattacc
ttcaaggatgtgaaccgggaatctgttacactgatgtgggatgcccctctccttgatggt
ggtgcccgaatccatcactatgtggtagagaagcgagaagcaagtcgccgtagctggcag
gttgtcagtgaaaaatgcactcgtcagatcctcaaggtcagtgacctggcagaaggcgtt
ccatactatttccgagtttctgcagaaaatgagtatggggttggtgaaccctatgaaatg
ccagaaccaatcgtagccacagaacagcctgctccacctaggagacttgatgttgttgat
acaagcaaatcctccgtggtcttagcttggctaaaacctgatcatgatggaggcagccgc
atcactggctacctgctcgaaatgagacaaaagggatctgacttctgggttgaagctggt
cacacgaaacagctgactttcacagtggagcgtcttgtggagaacactgaatatgaattc
cgtgtgaaggccaagaatgatgctggctacagtgaacccagggaagccttctcttcagtc
atcatcaaggagccccaaattgaacccactgctgacctcactggaatcaccaatcagctc
ataacttgcaaagcaggaagcacttttaccattgatgtgccaatcagtggtcgtcctgcc
ccgaaagtaacatggaaacttgaagaaatgagacttaaggacactgatcgagtgagtatc
acaacaacaaaagacagaaccactttgtccataaaggatagcatgcgaggtgactctggc
agatacttcttgaccctggaaaatacagctggcgttaaaacattcaccatcacagttgtg
gtcatcggaaggccaggtccagtaactggtcccattgaggtctcatctgtctcgtctgaa
tcatgtgtcctgtcatgggctgaacctaaagatgatggaggcactgacatcactaattac
atagttgaaaagcgtgagtctggtaaaacatcctggcagctcgtcaattccagtgtcaag
cgcacccaaattaaagtcactcatctcacaaaatacatggaatattctttccgtgtcagt
tcagagaatagatttggtgtcagcaagcctgtagaatcagcaccaatagttgctgagcat
ccatttgtcccgccaagtgctcctaccagacctgaagtttactctgtgtctgccactgcc
atgtctattcgttgggaagaaccataccatgatggtggcagtaaagtcattggctactgg
gttgagaagaaagaacgaaacaccattctttgggtgaaagaaaacaaagtgccatgcttg
gagtgcaactacaaagtgactggtttagtagaaggactggaatatcagttcagaacttat
gcacttaatgctgcaggtgttagcaaagccagtgaagcttcaagacctgtaatggctcaa
aatccagttgatgcaccaggaagaccagaggtgacggatgtcacaagatcaacagtgtca
ctgatttggtctgccccagtgtatgatggaggcagcaaggttgtaggctatatcatagaa
cgtaagccagtcagtgaagtaggagatggtcgctggctcaagtgcaactataccattgtg
tcagacaatttcttcactgtgactgctctcagtgaaggagacacttatgaatttcgagtg
ctggccaagaatgcagcaggcgtaattagcaaagggtcagaatctacaggtcctgttact
tgccgagatgaatacgctccacccaaagcccaactggatgccagattacaaggcgatctg
gtgaccatcagagcaggctcagatcttgttcttgatgctgcagttggtggtaaacctgaa
cccaaaattatctggaccaaaggagacaaggaactagatctctgtgaaaaagtctctttg
cagtatacaggcaaacgagcaaccgctgtgatcaagttctgtgacagaagtgacagtggg
aaatacactctaacggtgaagaatgccagtggaaccaaggctgtgtctgtcatggtcaaa
gtacttgattcccctggcccatgtggaaagctcactgttagcagagtaacagaggagaag
tgcactttagcctggagccttcctcaggaagacggaggagcagaaataactcattacatt
gtggaaagacgcgagacaagcaggctcaactgggtgattgttgaagacgaatgcccaacc
ctatcctatgtggttaccagaatgatcaagaacaatgaatacgtattccgagtgaaggca
gtgaacaaatatggacctggtgtacctattgaatcagagccaattattgccagaaactca
ttcactattccatcacaacctggcatacctgaagaagtaggtgctggcaaagaacatatc
atcattcagtggctaaaacctgaatctgatggtggcaatgagatcagcaactacttagtg
gacaaacgtgagaagaagagtctgcgctggacacgagtcaacaaggactatgtggtgtat
gataccaggctgaaggtgactggcctcatggaagggtgtgattaccaattccgcgtgact
gcagtgaacactgctggtaacagtgaacctagtggtgcttccaacttcatctcatgcaga
gagccatcatatacccctggaccaccttcttccccaagagttgtagataccaccaagcac
agcattagtttagcatggaccaagcccatgtatgatggtggtgctgacattataggatac
gttctcgaaatgcaagaaaaggacaccgatcagtggtaccgagtgcataccaatgccacg
ataagaaataatgaattcactgtgccagaccttaaaataggtcagaaatactcttttaga
gttgctgctgtgaacgtgaagggtatgagtgaatacagtgaatcaactgccgaaattgag
cccgtggaaagactagaaataccggatcttgagctttcagatgacctaaagaaaactgtg
accctcagggctggagcctcactgcgcctgatggtgtctgtatctggaagaccacctccc
atcattacatggagtaagaagggcattgaccttgcaagccgggcaattattgacaccact
gagagctacactttacttatcgtggacaaagttaatcggtacgatgctggaaaatacaca
attgaagccgaaaatcaatctggcaagaaatcagcaacagtccttgttaaagtgtatgat
actcctggtccctgtccttcagtgaaagttaaagaagtatcaagagattctgtgactatt
acttgggaaattcccacaactgacggtggagctccagtcaacaattacattattgagaaa
cgcgaagctgccatgagagcattcaaaacagtaacgaccaaatgcagcaaaacactttac
cgaatttcaggacttgtagaaggaaccatgtactatttcagagtgctgccagaaaatatt
tatggcattggagaaccttgtgaaacgtctgatgcggttctggtctcagaagtgccttta
gcacctacaaagttggaggtagtcgatgtcaccaaatcaactgttaccattgcctgggag
aaaccactctacgatggtggtagccgactcacaggctatgttcttgaggcctgcaaagct
ggcacagagcgatggatgaaggttgtcaccctaaaacccacagtcctggagcatactgtt
acctccttaaatgaaggtgaacagtacttatttagagtgagggcacaaaatgagaaaggc
atgtcagaagcaagagagatcgtcacagctgtgactgtacaagacttgagagtgttgcca
acgattgatctttctacaatgcctcaaaagaccatccatgtcccagctggccgaccagta
gaactggtgataccaattgctggtcgtccacctcctgctgcttcctggttctttgctggt
tccaaactgagagaatcagagcgtgttacagttgaaactcatactaaagtagctaaatta
accatccgtgaaaccactataagagatactggaaaatacacacttgaattaaagaatgta
actggaactacttcagagacaattaatgttatcattcttgacaagcctggtccaccaact
gggcctatcaagattgatgaaattgatgctacttcagttaccatttcctgggaaccaccg
gagttggatggtggcgctccattgagtggttacgtagtagaacaacgtgatgcccatcgt
ccaggatggctgccagtttctgaatcagtgactagaccaacatttaagtttactagactc
actgaaggaaatgagtatgtgttccgtgtggctgcaacaaatcgcttcggaattggctct
tacttgcaatctgaagtcatagaatgtcgcagcagcatcagtattcctggacccccagaa
acattacagatatttgatgtctcccgtgatggcatgacgctgacttggtatccaccagaa
gatgatggtggctcccaagtgactggatacattgtggagcgcaaagaagtgagagcagat
cgatgggtccgtgtaaataaagtaccagtgacgatgacacgataccgttccactggcctt
attgaaggcttagaatatgaacaccgtgtcacagccattaatgcaagagggactggtaaa
ccaagtcgtccttccaaacccattgttgccatggatccaattgctcctccaggaaagcca
caaaacccaagagttactgatacaacaaggacatcagtctccctggcctggagtgtccct
gaagatgaaggaggatctaaagtcacaggctacctaattgaaatgcaaaaagtagatcaa
catgaatggaccaaatgtaacactacccccaccaagattcgggagtatactctaacacac
ctacctcagggcgctgaatacagattccgagtcctagcttgtaatgctggtggacctgga
gagcctgcagaggtaccaggaacagtcaaagtcaccgaaatgcttgaatatcctgattat
gaactcgatgaaagataccaagaaggtgtctttgtaagacaaggtggagtcatcagactt
accataccaatcaaaggaaaaccactcccagtatgtaaatggaccaaggaaggccaagat
gttagtaagcgtgccatgattgcaacctctgaaacacacactgagctcgtaatcaaagaa
gcagacagggatgattctggcatctacgacctggctctggaaaacaaatgtggcaagaaa
gctgtttacatcaaggtcaaggtgattggaagtcccaactctccagaagggccacttgaa
tatgatgacatacaagctcgctctgtgagggtcagctggagacctcctgctgatgatggc
ggtgctgatattataggctacgttctcgagagacgagaagtacctaaagctgcctggtat
accattgattccagagtccgaggtacatctctggtggtaaaagggctcaaagaaaacgtg
gaataccatttccgtgtttcagccgaaaaccagtttggcataagcaaacccctgaaatct
gaggaaccagtcatacccaaaacaccactgaatcctccagagcctccaagcaatcctcca
gaagtactcgatgtgaccaagagttccgtcagcctgtcctggtcccgacccaaagatgat
ggtggttctcgtgtcaccggctactacattgaacgcaaagagacatcgactgacaagtgg
gtcagacacaacaagactcagataaccaccacaatgtacaccgttactggccttgtgcct
gatgctgaatatcagttccgcatcatcgcacagaatgatgttggcctaagtgagaccagc
cctgcttcagaaccagttgtttgcaaagatccatttgataaaccaagccaacctggagaa
cttgagatcctttcaatatccaaagatagtgtcactctacagtgggagaaacctgaatgt
gatggtggcaaagaaatccttggatactgggttgaatatagacagtctggagacagtgcc
tggaagaagagcagtaaagaccgtaccaaggacaggcagtttacagtaggaggtttgctg
gaagctactgaatatgaattcagagtttttgctgagaatgagaccggacttagcagacct
cgaagaactgctatgtctgtaaagactaagctaacatctggcgaggctccaggagtacgc
aaagaaatgaaggatgttatcaccaaattgggtgaagctgctcaactctcatgccagatt
gttggaaggcctcttcctgacattaagtggtgccgatttggtaaagagctcgtacaaagt
cggaaatataaaatgtcttcagatggacgcacacatactctgacagtaatgacagaggaa
caagaagatgaaggcgtctatacctgcatagctaccaatgaggttggagaagtagaaacc
agcagtaagcttctcctgcaggcaacaccacagttccatcctggttacccactaaaagag
aagtattacggtgctgtgggttctacacttcgacttcatgttgtgtacatcggccgtcca
gtacctgctatcacttggttctatggccagaagcttttgcaaaactcagaaaatattact
attgaaaatactgagcactacactcatcttgtcatgaagaacgtccagcgtaagacccac
gctgggaaatacaaagttcagctcagcaatgttttgggaacagttgatgccatccttgat
gtggaaatacaagataaaccagacaaaccgacaggaccaattgttattgaggctctactg
aagaattctgctgtaatcagctggaaaccacctgcagatgatggaggctcctggatcacc
aattatgtggtggagaaatgtgaggcaaaggaaggggctgaatggcaattggtgtcttca
gccatctcagtgacaacctgtagaattgtgaacctcacagaaaacgctggctattatttc
cgggtttcggctcagaacaccttcggcatcagtgagcctctagaagtcccatcagttgtg
atcattaagagtgcatttgaaaagccaagtgctcctggcaaaccaactattactgctctc
acaaaagattcttgtgttgtgacttggaagccacctcccagtgatggaggtgcaaagatt
agaaattactaccttgagaagcgtgagaagaagcagaataaatggattgctgtgacaaca
gaagaaattcgagaaactgtcttttcagtgcaaaaccttattgaaggtcttgaatacgag
ttccgtgtgaaatgtgaaaacttaggtggggagagtgaatggagtgaaatatcagaacct
gtcactcctaaatctgatgtcccgattcaggcaccacactttaaagaagaactaagaaat
ctaaatgtcaggtatcagagcaacgctactttggtctgcaaagtgactggtcatccgaaa
cctgttgtgaaatggtacagacaaggcaaagaaatcattgccgatggattaaagtacagg
attcaggagtttaagggtggctaccaccagctcatcattgcaagtgtcacggatgatgat
gccacagtttatcaagtcagagctaccaaccaagggggatctgtgtctggcactgcctcc
ctagaagtggaagttccagctaagatacacttgcctaaaaatcttgaaggcatgggagca
gttcatgctctccgaggtgaggtgatcagcatcaagatccctttcagtggcaaaccagat
cccgtgatcacctggcagaaaggacaagatctcattgataataatggtcactaccaagtt
attgtcacaagatccttcacatcacttgttttccccaatggagtggagagaaaagatgct
ggtttctatgtggtctgtgcgaaaaacagatttggaattgatcagaagacagttgaactg
gatgtggctgacgttcctgacccacccagaggagtcaaagttagtgatgtctcaagagat
tctgtcaacttaacgtggactgagccagcttctgacggtggcagcaaaatcaccaactat
attattgaaaaatgtgcaactactgcagagagatggctccgtgtaggacaggctcgagaa
acacggtatactgtgatcaacttatttggaaaaacaagttaccaattccgtgtaatagct
gagaataaatttggcctaagcaagccttctgagccttcagaaccaaccataaccaaagaa
gataagaccagagccatgaactacgacgaagaggtagatgaaacccgggaagtttgcatg
actaaagcatctcactcttcaaccaaggaactctatgagaaatatatgattgctgaagat
ctcggacgaggacagtttggaattgttcaccgttgtgttgaaacatcctcaaagaagaca
ttcatggccaaatttgtgaaagtcaaagggacagatcaagttttggtaaagaaggaaatt
tccattctgaacatggctagacacagaaacatcttatatctccatgaatcatttgaaagc
atggaagaattagttatgatctttgagttcatatcaggacttgacatatttgaacgcatt
aacacgagtgcttttgaacttactgaaagagaaattgttagttatgtccgccaggtctgt
gaagcacttgaattcttacatagtcataacatcggacactttgacattagaccagaaaat
atcatttaccaaacaagaagaagctccaccgttaaaatcatagaatttggtcaagcccgt
cagctgaagccaggggacaactttaggcttctgttcactgcccctgaatactatgcacct
gaagtccaccaacatgatgtcgtcagcacagccacagacatgtggtcacttggaaccttg
gtatatgtgctgttgagtggtatcaacccattcttggctgaaactaaccaacagataatt
gagaatatcatgaatgctgaattcacttttgatgaagaagcattccaagagattagcctt
gaagccatggattttgttgaccgtcttttagtgaaagagagaaaatcacgcatgacagca
tctgaggcactccagcacccatggctgaagcagaagatagaaaatgtcagcactaaagtt
atcagaacactaaaacaccggcggtactaccacaccctgatcaagaaagacctgaacatg
gttgtgtcagcagcccgaatctcctgcggtggtgcagttcgatctcagaaaggagtcagt
gttgctaaagttaaagttgcttccgttgaaatcggcccagtttctggacagataatgcat
gcagttggagaagaaagaggacatgtcaaatatgtatgtaaaattgaaaattatgatcaa
tctacccaagtgacttggtactttggtgtcagacagctggagaacaatgagaaatatgaa
atcacctatgaagatggactggcgaccatgtacatcaaagacatttccagatttgatgat
ggtacttacagatgcaaagtagtcaatgactatggtgaagacagttcttatgcagagcta
tttgttaaaggtgtgagagaagtttatgactactactgccgtagaaccacaaagaaaatt
aagcgcagaacagatacaatgagactcctggagaggccaccagaatttaccctgcctctc
tataacaagacagcttacgtgggtgaaaatgtccggtttggagtaaccataactgtccac
ccagagcctcgtgtaacatggtataaatcaggtcagaaaatcaaaccaggtgatgatgac
aagaaatacacatttgagtctgacaagggtctttaccaattaaccatccacagtgtaact
atagatgatgatgctgagtatactgttgtggcaaggaacaagtatggtgaagacagctgt
aaagcaaagctgaccataaccccacatctacctccatcagatacaaccttaagacccatg
ttcaaacggctactggcaaatgtagaatgccaagaaggccagagtgtctgctttgagatc
agagtgtctggcatcccccccccaacattaaaatgggagaaagacggtcagccgctgtcc
ctcgggcctaacattgaaattatccatgaaggcttggattattatgctctgcacatcagg
gatactttgcctgaggacacaggttattacagagtcactgccacaaacacagctggatcc
accagctgccaggcttacctacaagtggaacgcttgaggtacgtcaagcaggaattcaag
agtacagaggagcgcgaacgacatgtacaaagacaaattgacaagacactcagaatggct
gaaattctttctggaactgaaactgtgccactgacacaggtagcccaagaggctctaaga
gaagctgccattctttataaaccagctgtaagcaccaagactgtaaaaggggaatttaaa
cttcagcaggaagaaaagaaggaggaaagaaaactccgtatgccttatgaagtaccagag
ccacgcaagtacaaacagacaaccatagaagaagaccaacacattaagcagttcgtgcct
atgtctgacatgaaatggtataagaagatacgtgatcaatttgaaatgcctgggaaaatt
gacagagtggtacagaaaagacccaagcgtatccgcctctcaaggtgggaacagttctat
gtgatgcctcttccacgcattacagatcaatacagacctaaatggcgtattcccaagctg
acccaagatgatcttgaaatggtgagaccagcccgccggcgtacgccttctcctgattat
gacttttattacagacctaggagacgttctcttggtgacatgtcagatgaagaattactc
cttcccattgatgactacttagcaatgaaaagaacagaggaagagaggctgcgtcttgaa
gaagagcttgaattaggtttctcagcttcacccccaagccgcagccctccacgttttgag
ctttctagcctccgttactcttcaccacaagctcacgtaaaggtggaggaaacaagaaaa
gacttcagatattcaacctatcacattccagcaaaggctgaaactagtacaagttacgcg
gaactgcgggaacggcacgcccgggcctcgtatagacagccgaaacaacggcaaagaatc
atggctgagaaagaggatgaagaattgcttcgtccagttacaaccacccagcgtctctca
gaatacaaaagtgagcttgaccacatgtcaaaagaagaaaagtctagaaagaaatcaaga
cgacagagagaagtgacagaaataacagaaattgaggaagaatatgaaatctcaaaacgt
gctcaaaaagaatcatcttcatcagtatctagactactgagacgacggcgttccctgtct
ccaacttacattgagttaatgaggccagtttccgaactgatccggccacgtccacgacct
gctgaggaatctgaagatgacacagaaagaaggtcccctactccagagagaactcgccca
cgttctcccagtcctgtgtctagtgagagatcactctcaagatttgagaggtctgcaaga
tttgatatcttttccaggtatgagtccatgaaagctgctctaaagactcagaagacatca
gaaaggaagtacgaagttttgagtcagcagccttttacactggaccatgctcctcgaatc
acattgagaatgcgctctcacagggtgccatgtggccaaaatacatgttttatcttaaat
gttcagtctaagccaactgccgaggttaagtggtaccacaatggtgtagaactccaagag
agcagtaagattcattacaccaacacgagtggggtcctgactctggaaattctggactgt
catattgatgacagtggaacataccgtgctgtgtgcaccaactacaaaggtgaagcttct
gactatgcaaccttggatgtaacaggaggagattataccacctacgcttcccggcgcaga
gatgaagatgtccccagatctgttttccctgagctgacaaaaacagaggcatatgcagtt
tcatcatttaagaaaacatccgagatagaagcgtcttcttcagtcagggaagtgaaatca
catatgacagcaacacgggaaagtctctcatcatctgaacactatgcatctgcagaaatg
aaaagtgcagcattagaagaaaagtcgctggaagaaaaatccacacacagaaaaattaag
actactttggcggcaagaattctaacaaagccacggtctataactgtatatgaaggtgag
tctgccagattttcttgcgatacggatggtgagccagtacccactgttacgtggctgcgt
ggaggacaagtaataagtgtttctgcccgtcaccgagtgaccaccacaaagtacaaatcg
acctttgagatctcttcagtccaggcttccgatgagggcaactacactgtggtggtggaa
aacagtgaagggaaacaagaagcacagtttactttgactgttcacaaggccagggtcact
gaaaaggctgttacatcaccaccaagagtcaaatccccagagcctagagtgaaatcccca
gaagcagttaagtctccaaaacgagtgaagtccccagaaccagtgacttctcacccaaaa
gccacatcacccccagagacaaaacccataccaacagagaaagttcagcagctaccagtc
tctgctccaccaaagataactcagtctttgaaagcagaagcttctgaagatactgcaaag
ctgacgtgtgcggtggacagtagtgtactatgtgcaaaagaaatcacctggtataaagat
ggcaagaagctgaaggaaaatgggcattttcagtttcattattcagcagatggtacctat
gagctcaaaatccataacctcacagaatccgattgtggagaatatatttgtgagatttct
agtgaaggcggaacttccaaaactaacttccagtttgtgggccaagcctttaagagcatc
catgagaagttgtcaagcaaatcagaagccaagaaattagctcagaaacctgccgagtca
acagaaatcaagaaaatggcaccaaaagctcctgaaccaatttcctcaaaaccagtaatt
gttactgggctgcaggatacaactgtttcttcagatagtattgctaaattttcagtgaaa
gctactggagaaccctggccaactgtcatctggacaaaggatggaaaggttattacacaa
ggaggtaaatataaactctccgaagacaaaggaagattcattttagaaatacaaaagact
gatatttctgacagtgggctttataattgtacagtaacgaattcagctggatctgtgtct
tctagctgcaaattaacaataaaagttgcaaaagactctgaggcacagagagtgtctaca
caaaagacctctgaaactacatctcagaagatggcagttgtccaagaggaaattgcccaa
aaagccctaatttctgaagaaatcaagatgtcagacgtgaaatctcaagaaaagttagcc
ctcaaggaggaagcttcaaaggtcctgatttccaaagaagtcaagaaatcagaagcagcc
tccctggaaaaatcctttgtccatgaggaaatcactaaaacatcacagatatcagaagat
atcaaaacccatgctgagattaaagcattttctactcagatgagcattaccgatggtcaa
aaagtgactttaaaagccaacattgctggtgccactgatgtgaaatgggtactgaatgga
atggagctcgccaactctgaggaatacagatatggcgtctcaggcagtgatcagaccctt
accatcaagcaagccagccacagagatgagggaatactgacctgcataggcaaaaccagt
caaggcattatcaagtaccagtttgatatgactctgagcaaagagctctcagatgctcca
gccttcatcacccagcccagatctcaaaatgttaatgaaggacaaaatgttcacttttct
tgtgaaatcagtggtgagccatcccctgaaatcgaatggtttaaagacaacctaccaatt
tctgtttcttcaaatatcagtgtaagtcgctccagaaatgtatattctcttgaaatccga
aatgcgtcagtcagagacagtggaaagtatacaattaaggccaaaaatttccggggccaa
tgttcagcgacagcgtccttaacggtccttcctctagttgaagaaccttccagagaggta
gtactgaggacaagtggtgacaccagcttgcaaggaagcttctcgtctcagtcagtccaa
atgtctgcctctaagcaggaggcctccttcagcagtttcagcagcagcagtgctagtagc
agcatgactgaaatgaaatttgcaagcatgtctgcccaaagcatgtcctccatgcaagag
tcctttgtagaaatgagttccagcagttttatgggacaatctagtatgacacaactggaa
agctcaactcgtagaatgcttaaagcaggcgtaagaggaattccgcctaaaattgaagct
cttccccctgatatcagcattgatgaaggcaaagttctaacagtagcctgtgctttcacc
ggtgaacctacccctgaaataacatggtcccgtggtggaagaaaaattcaaaatcaagaa
caacaaggaagattccatattgaaaacacagatgacctgacaactctgatcatcatggac
gtacagaaacaagatggtggactttataccctgagcttagggaatgaatttggatctgac
tctgccactgtgaatataaatattcgatccatgtaa

DBGET integrated database retrieval system