KEGG   Loxodonta africana (African savanna elephant): 104845647
Entry
104845647         CDS       T04351                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104845647
   04115 p53 signaling pathway
    104845647
   04218 Cellular senescence
    104845647
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104845647
   05206 MicroRNAs in cancer
    104845647
   05203 Viral carcinogenesis
    104845647
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104845647
   05225 Hepatocellular carcinoma
    104845647
   05214 Glioma
    104845647
   05220 Chronic myeloid leukemia
    104845647
   05218 Melanoma
    104845647
   05219 Bladder cancer
    104845647
   05223 Non-small cell lung cancer
    104845647
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104845647
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104845647
   05163 Human cytomegalovirus infection
    104845647
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104845647
   01522 Endocrine resistance
    104845647
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Arm-DNA-bind_3
Other DBs
NCBI-GeneID: 104845647
NCBI-ProteinID: XP_010586196
LinkDB
Position
Unknown
AA seq 152 aa
MEPTADSLATAAARGRAREVRALLRAGAQPNAPNRYGRRPIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLMVLHRAGARLDVRDAWGRLPVDLAEERGHRDVSL
YLRAAARDTEGGDRAHGDAAEGSAVVRRQRQL
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcccaccgccgactcgctggccacggcggccgcccgaggccgggcccgggaggtg
cgggcgctgctgcgggcgggggcgcagcctaacgcgccgaaccgctacgggcgccgcccg
atccaggtcatgatgatgggcagcgcccgtgtggcggagctgctgctgctccacggcgcg
gagcccaactgcgcagaccccgccaccctcacccgaccggtgcacgacgccgcgcgggag
ggcttcctggacacgctgatggtgctgcatcgcgccggggcgcggctggacgtgcgcgac
gcctggggccgcctgcccgtggacctggctgaggagcggggtcaccgcgacgtctccctg
tacctgcgtgcggccgcgagggacaccgaaggcggcgaccgcgcccatggagacgccgca
gagggctcagcagttgttcgcagacagcgccaactgtaa

DBGET integrated database retrieval system