KEGG   Loxodonta africana (African savanna elephant): 104845742
Entry
104845742         CDS       T04351                                 

Gene name
OPRM1
Definition
(RefSeq) mu-type opioid receptor
  KO
K04215  mu-type opioid receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04915  Estrogen signaling pathway
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104845742 (OPRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104845742 (OPRM1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104845742 (OPRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    104845742 (OPRM1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Opioid
    104845742 (OPRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx DUF2824
Other DBs
NCBI-GeneID: 104845742
NCBI-ProteinID: XP_010587221
LinkDB
Position
Unknown
AA seq 401 aa
MDSGSGPAISSNCTDPFTSSASCSPAPSPRSWVNLSHLDGNLSDPCGPNRTELGGSDSLC
PPTGSPSVITAITITALYSIVCVVGLFGNFLVMYVIIRYTKMKTATNIYIFNLALADALA
TSTLPFQGVNYLMGTWPFGTIICKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALD
FRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRHGSVDCTLTFSHPTWYWENLLKICVF
IFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH
IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPNSST
IEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEVETVPLP
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggacagcggctccggtcccgcgatctccagcaattgcaccgatcctttcacgagctct
gcaagttgctccccagcacctagccccaggtcctgggtcaacttgtcccacttagatggc
aacctgtccgacccgtgcggtccgaaccgtaccgagttgggcgggagcgacagcttgtgc
cctccgaccggcagtccttcagtgatcacagccatcaccatcacagccctctactccatc
gtgtgcgtggtgggtctcttcggaaacttcctggtcatgtatgttattatcagatacacc
aaaatgaagactgccaccaatatctatattttcaaccttgctctggcagatgccttggcg
accagtaccctgcccttccagggtgtcaattacctgatgggaacgtggccgtttggaacc
atcatttgcaagattgtcatctccatagattattacaacatgttcaccagcatctttacc
ctctgcaccatgagtgttgatcgctacattgcagtctgccacccagtcaaggccctggat
ttccgtaccccccgaaatgccaaaattgtcaatgtctgcaactggatcctttcgtcagcc
attgggctgccagtaatgttcatggcaacaacgaaatataggcatggttccgtagactgt
accctaacattctctcacccaacctggtactgggaaaacctgctgaaaatttgtgtcttc
atctttgccttcatcatgcctgtcctcatcatcactgtgtgttatggactgatgatctta
cgcctcaagagtgtccgcatgctgtctggctccaaagagaaggacaggaacctgcgcaga
atcaccaggatggtgctggtggttgtggccgtgttcatagtttgctggactcccattcac
atctatgtcatcattaaagccttgattaccatcccagaaactaccttccagacggtttcc
tggcacttctgcattgctctaggttacacaaacagctgcctgaacccagtcctgtatgcc
tttctggatgaaaacttcaaacgatgcttcagagagttctgtatcccaaactcctccacc
atcgagcaacagaattccactcgaattcgtcaaaacacgagagaccacccttccactgcc
aataccgtggacaggactaaccatcagctagaaaatctggaagtggaaactgttccattg
ccataa

DBGET integrated database retrieval system