KEGG   Loxodonta africana (African savanna elephant): 104846049
Entry
104846049         CDS       T04351                                 

Gene name
MAFB
Definition
(RefSeq) transcription factor MafB
  KO
K09036  transcription factor MAFB
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104846049 (MAFB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    104846049 (MAFB)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    104846049 (MAFB)
SSDB
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 KASH_CCD HOOK APC_N_CC DUF4164 bZIP_2 MbeD_MobD DUF2353 UPF0449 Uso1_p115_C JIP_LZII
Other DBs
NCBI-GeneID: 104846049
NCBI-ProteinID: XP_010589986
LinkDB
Position
Unknown
AA seq 482 aa
MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL
STPCSSVPSSPSFSPTEKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPL
QSFDGFRGAHHHHHHHHHPHPHHAYQAAGVAHDELGPHAHPHHHHHHQASPPPSNAASPT
QQLPTSHPGAGPHAAAAATAAGGSGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK
QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK
LANSGFRRGGLHQRQPLLSRVLSVSRGRSRPPPLPRPGLPVPCPQSRNLPDPVPATAPAL
TCLTWRGRKGARAAGDGRARGRVGDLGQGESNARQRRLLDWSRARERPEGGRSQSNFSPG
WRAARHSPKESPRPSGDSWLSELCALSRGRFLVARSAVRPRKRAARRGEEGNPGVPAGER
QG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggccgcggagctgagtatggggcccgagttgcccaccagcccgctggccatggagtat
gtcaatgacttcgacctgctcaagttcgacgtgaagaaggagccgctggggcgcgccgag
cgcccgggacggccctgtacgcgcttgcagccggccggctcagtgtcgtccacgccgctc
agcacgccgtgtagctcggtgccctcgtcgcccagcttcagccctaccgagaagacccac
ctcgaggacctgtactggatggcgagtaactaccagcagatgaaccccgaggcgctcaac
ctgacgcccgaagacgcggtggaggctctcatcggctcgcacccagtgccacagccgctg
cagagcttcgacggcttccgcggcgcgcaccaccaccaccatcaccaccaccacccacac
ccgcaccatgcgtaccaggctgccggcgtggcccacgacgaactgggcccacatgcgcac
ccgcaccatcaccaccatcaccaagcgtcgccgccgccgtccaacgcggccagccccacg
cagcagctacccaccagccaccccggggcagggccgcatgctgcggccgcggcgacggcg
gctggcggcagcggcagtgtggaggaccgcttctccgacgaccagctcgtgtccatgtcg
gtgcgcgagctgaaccgccacctgcggggcttcaccaaggacgaggtgatccgcctgaag
cagaagcggcggaccctgaagaaccggggctacgcccagtcttgcaggtataaacgcgtc
cagcagaaacaccacctggagaatgagaagacgcagctcattcagcaggtggagcagctt
aagcaggaggtgtcccggctggcccgagagagagacgcctacaaggtcaagtgcgagaaa
ctcgccaactccggcttcaggagaggcgggctccaccagcgacagcccctcctctcccga
gttctttctgtgagtcgtggccggtctcggcccccgcccttgccccggcccggactcccc
gtcccgtgtccccagtcccggaacctcccggaccctgtccctgccacggccccagccttg
acctgtttgacttggagagggaggaagggcgcgcgggccgcgggcgacgggcgggcgcgc
gggcgggtaggggatctcggccaaggcgagagcaacgcgcgccagcgccgcctcctagac
tggagcagagccagagagagaccagagggtgggaggtcccagagcaacttttctccaggc
tggagggcagcgaggcatagtcctaaggagtcgccaaggccgtctggagactcctggctt
tctgaactttgcgcgttaagccggggccgcttcctcgttgcccggagcgcagtccgcccg
aggaagagagcagcgaggagaggagaggaggggaaccctggcgtacccgcaggcgagaga
caaggctga

DBGET integrated database retrieval system