KEGG   Loxodonta africana (African savanna elephant): 104846165
Entry
104846165         CDS       T04351                                 

Gene name
KLF2
Definition
(RefSeq) LOW QUALITY PROTEIN: Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04371  Apelin signaling pathway
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104846165 (KLF2)
   04068 FoxO signaling pathway
    104846165 (KLF2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104846165 (KLF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    104846165 (KLF2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    104846165 (KLF2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 104846165
NCBI-ProteinID: XP_010591549
LinkDB
Position
Unknown
AA seq 134 aa
MWQSGYRVPSRLSQASHRREPGSPGRPAASCWRPNPSADRRSWPRKRTATHTCSYAGCGK
TYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAF
SRSDHLALHMKRHM
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtggcagtcggggtaccgggtcccctcccggctctcccaggcctcacacaggcgggag
ccggggagccctgggcgtcccgccgctagctgctggaggccaaacccaagcgcggaccgc
cgctcctggccccgcaagcgcacggctacgcacacctgcagctatgccggctgtggcaag
acgtacaccaagagctcacacctcaaggcgcacctgcgcacgcatacaggcgagaaaccc
taccactgcaactgggacggctgcggctggaagttcgcgcgctcggatgagctcacgcgg
cactaccgcaagcacacgggccaccggccgttccagtgccacctgtgcgaccgcgccttc
tcgcgctcagaccacctggcgctgcacatgaagaggcacatgtag

DBGET integrated database retrieval system