KEGG   Loxodonta africana (African savanna elephant): 104846349
Entry
104846349         CDS       T04351                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04919  Thyroid hormone signaling pathway
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104846349 (SLC9A1)
   04024 cAMP signaling pathway
    104846349 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104846349 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104846349 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104846349 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    104846349 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    104846349 (SLC9A1)
   04971 Gastric acid secretion
    104846349 (SLC9A1)
   04972 Pancreatic secretion
    104846349 (SLC9A1)
   04976 Bile secretion
    104846349 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104846349 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    104846349 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    104846349 (SLC9A1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104846349 (SLC9A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   104846349 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 104846349
NCBI-ProteinID: XP_010593420
LinkDB
Position
Unknown
AA seq 476 aa
MAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLG
VSTVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLSPKDQFIIAYGGLRG
AIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSIN
EEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHK
MEMKQAIELVESGGMGKIPSAVSTVSMQNIHPKALPAERILPALSKDKEEEIRKILRNNL
QKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRA
RIGSDPLAYEPKADLPVITIDPASPQSPESVDLVNEELKGKVMGLSRDPERLAEEDEDDD
GGIVMRTKEPPSPGTDEVFTPGPSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcctacctgtcagccgagctcttccacctgtcgggcatcatggcactcattgcctca
ggagtggtgatgcgcccctacgtggaagccaacatctctcacaagtcccacacgaccatc
aagtactttctgaagatgtggagcagtgttagcgagaccctcatcttcatcttccttggt
gtctccaccgtggctggctcccaccattggaactggacctttgtcatcagtaccctactc
ttctgcctcatcgccagagtgctaggagtgctgggcctgacctggttcatcaacaagttc
cgcatagtgaagctgagccctaaggaccagttcatcatcgcctatgggggcctgcgaggg
gccatcgccttctccctgggctacctcctggacaagaagcacttccccatgtgtgacctg
ttcctcactgccatcatcaccgtcatcttcttcaccgtctttgtgcagggcatgaccatt
cggcccctggtagacctgttggctgtgaagaaaaagcaagaaacaaagcgctccatcaat
gaggagatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggc
cactatggccaccaccactggaaagacaagctcaaccggtttaataagaagtatgtgaag
aagtgtctgatagctggtgagcgctccaaggagccccagctcatcgccttctaccacaag
atggagatgaagcaggctattgagctggtggaaagtggaggcatgggcaagattccctcc
gctgtctctactgtctccatgcagaacatccaccccaaggccctgcctgccgaacgtatc
ctgccagcattgtccaaggacaaggaggaggagattcgcaaaatcctgaggaacaacttg
cagaagaccaggcagcggctgcggtcctataacagacacacgctggtggcagacccctac
gaggaggcctggaaccagatgctgctccggagacagaaggcccggcaactggagcagaag
atcaataactacctgacagtgcctgcccacaagctggactcacccaccatgtctcgggcc
cgcatcggctcagaccccctggcctatgagccaaaggcagatctgcctgtcatcaccatc
gacccagcctccccacagtcaccggagtctgtggacctggtgaacgaggagctgaagggc
aaggtcatggggctgagccgggatcctgagaggctggctgaggaagatgaggatgacgac
gggggcattgtgatgcggaccaaggagcccccatctccaggcaccgatgaagtcttcacc
cctgggcccagtgacagtcccagttcccagagaatacaacgctgcctcagtgacccaggc
cctcatcctgagcctggggagggagagcccttcatccccaaggggcagtaa

DBGET integrated database retrieval system