KEGG   Loxodonta africana (African savanna elephant): 104847161
Entry
104847161         CDS       T04351                                 

Gene name
MUC5B
Definition
(RefSeq) LOW QUALITY PROTEIN: mucin-5B
  KO
K13908  mucin-5B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04657  IL-17 signaling pathway
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    104847161 (MUC5B)
  09154 Digestive system
   04970 Salivary secretion
    104847161 (MUC5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    104847161 (MUC5B)
Membrane trafficking [BR:lav04131]
 Others
  Mucins
   Secretory mucins
    104847161 (MUC5B)
SSDB
Motif
Pfam: VWD C8 TIL VWC
Other DBs
NCBI-GeneID: 104847161
NCBI-ProteinID: XP_023397349
LinkDB
Position
Unknown
AA seq 1201 aa
MVDTDREFTAVWSLLKTLDTSPGPANPAGSESTRGSWRKGGPMFAHELCHLRPAPTLPRM
FAGACHVVPRRDEIPSIIEHLLFARGLLASPKAPPGVGTRGLPRHGSEGGEEEEAGSLST
PSQGRMRTGSRCPAHAETCATSGPVQSPDLWATGIAASEDHGSENHGSSSHLCTSQVVEG
SGRVGALNLCGSESSPRMGTRSQCPALAWALMVLLSAQQAAQAFLLGGHHLQSMGWDQGQ
TETQGSEEPSRMSREAVTDGQRMNGVQTTPSPTRRLTFIPPITMSPSMSPLNPAHNGRVC
STWGDFHYKTFDGDIFRFPGLCNYVLSSHCRAAYEDFNIQVRRELLGARPTISRIVLKVE
GLVLEVANGSVLIDGQGXVLPYSRAGLLVERSSSYVKISVRMVLTFLWNGEDSALEDACR
RTLLGSAFAQCNKLVDPDPYVASCAQDQCRCPSCPCATFAEYSRQCAHAGGQPQNWRGPN
LCSQTCPAGMQHQECGSPCADTCSNPERTQLCEDHCEDGCFCPPGTVLDDVTHSGCVPLP
QCPCTHGGRTYAPGAAFATSCSSCTCSGGRWQCKDLPCPGTCSVQGGAHITTYDEKLYDL
HGDCSYVLSKRCADSAFTVLAELRRCGLTDTESCLKSVTLSLQGGDTVIRIQANGAVFMN
SIYTQLPVSAANIKVFRPSSFFVLVQTGLGLQLQVQLVPLMQVYVRLDPAHHGQMCGRPP
SPPDCMFDTCNCEKSEDCLCAALSAYVHTCAAKGVLLQGWRDGVCTKYMNSCPKSQSYEY
VVDTCQPTCRALSEADVTCGVSFVPVDGCTCPVGTYLDDAGMCVHAEECPCYLRGTMVAP
GEVLHDNSVVCSCTSGKLSCLGALEQRSTGCVAPMVYMDCTNASAGSLGAECLRSCHTLD
VDCYSTHCVSGCVCPTGLVSDGSGGCVAQEDCPCVHNEATYQPGDTIRVDCNTCTCRNRR
WECSSQPCLGTCVAYGDGHFITFDGERYSFEGSCEYMLAQDYCGGTATTNGTFRIVTENI
PCGTTGVTCSKAIKLFLESYELILMEGHLKVVERGPGGDLPYKIRYMGIYLVIEIRSGLV
VSWDRKTSIFIRLHPGYKGKVCGLCGNFDGNAINDFTTRSQSVVGDVLEFGNSWKFSPSC
PDARAPRDPCTANPYRKSWAQKQCSILHGATFAACQSQVTADKRTPERGLHRLISPLSPM
P
NT seq 3606 nt   +upstreamnt  +downstreamnt
atggtggacactgaccgagagttcacagcggtctggtccctactcaagaccctggacaca
tcacctggccctgccaaccccgcaggctctgagtcaacacggggttcctggaggaaagga
gggcccatgtttgcccacgaactctgtcatctccggccagcgcccaccttgccgcgcatg
tttgctggagcatgccacgttgtccccaggagggatgagatccccagcatcattgagcac
ctgctgtttgcccgagggctactggcttccccaaaagcccctccgggggtggggacaagg
gggctgcctagacatggcagtgagggcggggaggaggaggaggcgggcagcctgagcacc
ccatcccagggccggatgcgcacggggagcaggtgtccagcccatgctgaaacctgtgcc
acctcgggcccagtccagagcccagatctgtgggccacaggcatagcggcatccgaagac
cacggcagtgagaaccatgggagcagcagccacctttgcaccagccaggtggtggagggc
agtggccgagtgggagctctgaacctctgtggctcggagagcagccccaggatgggcaca
aggagccagtgcccggcactggcctgggccctcatggtcctgctctcggcacagcaggca
gcacaggccttcctgctgggtggacaccacctccagtccatgggctgggatcagggccag
acagagacccagggcagtgaggagcccagcaggatgagcagggaggctgtcacagatggt
cagaggatgaatggcgtccagaccacaccctcacctacccggcgcttgaccttcatccca
cccatcaccatgtctcccagcatgagccccctgaaccctgcacacaacgggcgggtctgc
agcacgtggggtgacttccactataagaccttcgacggtgacatcttccgcttccccggc
ctctgcaactatgtcctgtcctcgcactgccgcgccgcctatgaggacttcaacatccag
gtgcgccgagagctcttgggcgccaggcctaccatcagccgcatcgtcctcaaggtggag
gggctggtgctggaggtcgccaacggctcagtgctcatcgacgggcaggggtgagtgctg
ccctacagccgtgctgggctcctggtggagcgcagcagcagctacgttaagatcagtgtc
cggatggtcctgaccttcctctggaatggagaggacagcgccctggaggatgcctgccgc
cgcaccttgcttggctctgccttcgcccagtgcaacaagctggtggaccccgacccgtac
gtggcctcctgtgcccaggaccagtgtcgctgccccagctgcccatgtgccacctttgcc
gagtattcccgccaatgtgcccatgcagggggccagccacagaactggaggggccccaac
ctctgctcccagacatgcccagctggcatgcagcaccaagagtgtggctcgccctgcgcc
gacacctgctccaaccctgagcgcacccagctctgtgaggaccactgtgaggacggctgc
ttctgtcccccaggcacggtgctggatgatgttacccactcaggctgtgtgcccctgcct
cagtgcccctgcacccatggtggccgcacctacgccccgggggctgccttcgccaccagc
tgcagctcctgcacctgttcggggggacggtggcaatgcaaggacctcccatgcccgggc
acctgctccgtgcaggggggcgcccacatcaccacgtatgacgagaagctgtatgatcta
cacggggactgcagctatgtcctgtccaagagatgcgctgacagcgccttcactgtgctg
gccgagctgaggaggtgtggcctgacagacactgagagctgcctcaagtcagtgacgctc
agcctgcagggtggggacacggtcatccggatccaggccaatggtgcagtgttcatgaac
tccatctatacccagctgccagtgtcagcagccaacatcaaggtcttcagaccctcatcc
ttcttcgttctcgtgcagacggggctcggcctgcagctgcaggtgcagctggtgcccctc
atgcaggtctacgtccggctagacccggcccaccatggccagatgtgtggacggccccct
tcccccccagactgcatgttcgacacgtgcaactgcgagaagagcgaggactgcctgtgc
gccgccctgtcggcctacgtgcacacctgcgctgccaagggtgtgctgctgcaaggctgg
agggacggtgtctgcaccaagtacatgaacagctgccccaagtcacagagctatgagtac
gtggtggacacctgccagcccacctgccgcgccctcagtgaggcagacgtcacttgtggt
gtctccttcgtgccggtggatggctgcacctgccctgtgggcacctacctggatgatgcc
ggcatgtgtgtgcatgctgaggagtgcccctgctacctgcgcggcaccatggtggccccg
ggcgaagtcttacatgataacagtgtggtgtgctcctgcactagtgggaagctgagctgc
ctgggagccctggagcagaggagcacagggtgcgtggcccccatggtttacatggactgc
accaacgcctcggcaggaagcctaggggctgagtgcctgcggagctgccacacccttgac
gtggactgttacagtacccactgtgtctccggttgtgtctgccccacggggctggtgtca
gatggcagcggggggtgtgttgcccaggaggactgcccctgtgtgcacaatgaggccacc
taccagcctggggacaccatcagggttgactgcaacacctgcacatgcaggaaccggagg
tgggagtgcagcagccagccctgcctgggcacctgtgtggcctatggtgacgggcacttt
atcaccttcgacggtgagcgctacagctttgaaggcagctgcgagtacatgctggcccag
gactactgcgggggcaccgctaccaccaacggaaccttccggatagtcaccgagaacatc
ccctgtggcaccaccggcgtcacctgctccaaggccatcaaactcttcctggagagctat
gagctgatcctcatggaggggcacctgaaggtggtagagagggggcctggtggagacctc
ccctacaagatccgctacatgggcatctacctggtcattgagatccgaagtgggctggtc
gtgtcgtgggaccggaagaccagcatattcatcaggttgcacccgggctacaaggggaag
gtgtgtgggctgtgcggcaacttcgacggcaacgccatcaacgacttcaccacgcggagc
cagtcggtagtgggtgacgtgctggagttcggcaacagctggaagttctcgccgtcctgt
ccggacgcccgcgcccccagggacccgtgcactgccaacccataccgcaagtcctgggcc
cagaagcagtgcagcatcctccatggggccaccttcgccgcctgccagtctcaggtgact
gcagacaagaggacccctgagcgggggctgcacaggctaatctcgccactgtcccccatg
ccctga

DBGET integrated database retrieval system