KEGG   Loxodonta africana (African savanna elephant): 104847204
Entry
104847204         CDS       T04351                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04630  JAK-STAT signaling pathway
lav04640  Hematopoietic cell lineage
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104847204 (IL3RA)
   04151 PI3K-Akt signaling pathway
    104847204 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104847204 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104847204 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104847204 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104847204 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    104847204 (IL3RA)
   04090 CD molecules [BR:lav04090]
    104847204 (IL3RA)
Cytokine receptors [BR:lav04050]
 Interleukin receptor families
  IL3 receptor family
   104847204 (IL3RA)
CD molecules [BR:lav04090]
 Proteins
  104847204 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind PKD
Other DBs
NCBI-GeneID: 104847204
NCBI-ProteinID: XP_023397718
LinkDB
Position
Unknown
AA seq 327 aa
MSFVWLAVFLTPVGSLLERDPDPGAPISNIRVDPRRGRVVWDLNGSVAEVTCSTGSVYLS
KADNTTTYCQFYAFLLCKTTNYTITVTSGPPFSTVIQYPKPDGKPGAAAENLTCWIHDVD
FLECSWAVGKAAPWDVQYHLYLIETPNYEEWHVALHYGYAGNTYRLSFRHISKLKNHHHH
FVVNGTSEGFIIPCTEIFATLSEIEILAPPSLSGRCNKSYSLMEWNMSSHFIWDFIYELQ
IQKGTDPTHLNTPIVTDKNSHELVNPGTYVARIRARNNFGNTWSGWSPPRSFGEHGPVLF
CFCPASQLCTIPCPRNTSPLACEPTES
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtcctttgtctggctcgcggtgtttctgacgcccgtcggcagcctgctggaaagggac
cccgatccaggcgcaccaattagcaacatcagggtggatccaagacgaggaagagtggtc
tgggacctcaacggaagtgtcgccgaagttacctgctccacaggctcagtgtatctcagc
aaggcagacaataccaccacctactgccagttttatgcatttcttctgtgcaaaacgacc
aactataccataacagtgaccagtggcccgccgttttcaactgtgattcagtatcctaag
ccagatgggaagccgggggcagctgcggagaacctgacctgctggatccatgatgtggac
ttcctagagtgcagctgggctgtgggcaaggcagccccctgggacgtccagtaccacctg
taccttattgaaacccccaactacgaagagtggcatgtggcattacactacggatatgcg
gggaatacataccggctgtcatttcgacacatctctaagctaaaaaatcaccaccaccac
ttcgtggtgaatgggaccagtgagggattcataatcccgtgcaccgagatctttgccacg
ttgtcagagattgagatactggctcctcctagcctcagtgggaggtgcaataagtcatat
tccctcatggagtggaatatgtcaagtcatttcatctgggactttatctatgagcttcag
atacaaaagggcacggatcccacccacctaaacacgcctatcgtgacggacaaaaactcc
catgagctcgtgaaccccggaacgtacgtggcgaggatcagagccaggaacaactttggg
aacacatggagcgggtggagtccgccccggagttttggtgagcatggccctgttttgttc
tgcttctgtcctgcgtcacagttgtgcaccatcccttgtcccagaaatacatccccactt
gcctgcgagcccaccgagagctga

DBGET integrated database retrieval system