KEGG   Loxodonta africana (African savanna elephant): 104847364
Entry
104847364         CDS       T04351                                 

Definition
(RefSeq) uncharacterized protein LOC104847364
  KO
K06856  immunoglobulin heavy chain
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04064  NF-kappa B signaling pathway
lav04072  Phospholipase D signaling pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04613  Neutrophil extracellular trap formation
lav04640  Hematopoietic cell lineage
lav04650  Natural killer cell mediated cytotoxicity
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04672  Intestinal immune network for IgA production
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05150  Staphylococcus aureus infection
lav05152  Tuberculosis
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05202  Transcriptional misregulation in cancer
lav05310  Asthma
lav05320  Autoimmune thyroid disease
lav05322  Systemic lupus erythematosus
lav05323  Rheumatoid arthritis
lav05330  Allograft rejection
lav05340  Primary immunodeficiency
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104847364
   04020 Calcium signaling pathway
    104847364
   04072 Phospholipase D signaling pathway
    104847364
   04151 PI3K-Akt signaling pathway
    104847364
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104847364
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104847364
   04613 Neutrophil extracellular trap formation
    104847364
   04650 Natural killer cell mediated cytotoxicity
    104847364
   04662 B cell receptor signaling pathway
    104847364
   04664 Fc epsilon RI signaling pathway
    104847364
   04666 Fc gamma R-mediated phagocytosis
    104847364
   04672 Intestinal immune network for IgA production
    104847364
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    104847364
  09163 Immune disease
   05310 Asthma
    104847364
   05322 Systemic lupus erythematosus
    104847364
   05323 Rheumatoid arthritis
    104847364
   05320 Autoimmune thyroid disease
    104847364
   05330 Allograft rejection
    104847364
   05340 Primary immunodeficiency
    104847364
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    104847364
   05416 Viral myocarditis
    104847364
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104847364
   05150 Staphylococcus aureus infection
    104847364
   05152 Tuberculosis
    104847364
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104847364
   05169 Epstein-Barr virus infection
    104847364
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104847364
   05140 Leishmaniasis
    104847364
   05143 African trypanosomiasis
    104847364
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    104847364
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Opsonins
    104847364
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 104847364
NCBI-ProteinID: XP_023398459
LinkDB
Position
Unknown
AA seq 259 aa
MTEEQMEIVEVYGVVHPLGCGDACTEMHAFSPEEDVHQAYTGDRMSAGVLSQVQLKESGP
GLVKPSQTLSLTCTVTGGSISSDYAWSWIRQPPGKGLEWLGVGYYSRSSWNTKYGSSVQG
RISITADSSKKQFSLQLSSVTSEDTAVYYCATGTVKSVYPKTKTSPAVRGLAYGRRSECM
EHRDHLRSRCRGRLKFPFNPGVSCPCPAKVLSSKNRYCLFLANRKRLPNKHGQHMLLSVY
FISTCLVVFTLQAHAYLAF
NT seq 780 nt   +upstreamnt  +downstreamnt
atgacagaggaacaaatggaaatcgttgaagtgtatggagttgttcaccctcttggttgt
ggtgatgcttgcactgagatgcacgccttctccccagaggaggatgttcaccaggcttat
acaggtgacagaatgtctgcaggtgtcctgtcccaggtgcagctgaaggagtcaggccca
ggactggtgaagccgtcacaaaccttgtctctcacctgcactgtcactggtggctccatc
tctagtgattatgcttggagctggatccgccagcccccagggaagggcctggaatggctg
ggagttggttactacagtagatcatcatggaatacaaagtatggctcctccgtccagggc
cgaatctccatcactgctgactcatccaagaagcagttctccctgcagctgagctctgtg
acttccgaggacacagccgtgtattactgtgcaacaggcacagtgaagtccgtgtacccc
aagacaaaaacctcccctgcagtgagaggactggcctatgggaggcgctcagaatgcatg
gagcacagagatcatcttaggagcaggtgcagaggaagactgaagtttccttttaaccct
ggtgtttcctgcccctgcccagcaaaagtcttatcctcgaagaaccgttactgtctcttc
cttgcaaacaggaagagattaccgaataagcacggtcagcacatgcttcttagtgtgtac
tttataagcacatgcttagttgtgtttaccttgcaagcccatgcttaccttgctttctga

DBGET integrated database retrieval system