KEGG   Loxodonta africana (African savanna elephant): 111749764
Entry
111749764         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: protein piccolo-like
  KO
K16882  protein piccolo
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111749764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    111749764
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    111749764
SSDB
Other DBs
NCBI-GeneID: 111749764
NCBI-ProteinID: XP_023400423
LinkDB
Position
Unknown
AA seq 2575 aa
MSVERRDQEMSDRREKWEKEDDKSDASSSQQPKSPQGLSDTGYSSDGISSSLGEIPSHIP
SDEKDLLKGLKKDFFSQESSPSSPSDLAKLESTVLSILEAQSSTLVDEKSEKKTKPQGVS
PEQPKDQQKTQTFSETLEITVPEEPPKESQEEKKDTFKKDDQQGHPFQKRTIKKSLSLLM
NIAGRRQTYDSVEDSSESENSPVPQRKRRTSVGSSSSDEYKQEDSQGSGEEEDFIRKQII
EMSAGEDASGSEDDEFIKNQLKEISSSIESQKKEETKGKGKATAGKHKRLTRKSSASFDD
DVGRRHSWHDEDDEMYDDSSELKYRETKSQESEELAVAGGGGLRRFKTIELNSTITDKYS
AESSQKKTTLYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDS
DSSPSHKKGESKQQRKARHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQRELEQQQRK
TSSKKSKKDKDELRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSP
SIESDPEGFEISPEKIIEVQKVYKLPTAVSLYSPTDEQSIMQKEGGQKALKSAEEMYEEM
IHKSHKYKAFPAANERDEVFEKEPLYGGMLIEDYIYESLVEDTYNGSVDGTLLTREDEEN
GFMQQKGREQKIRLPEQIYEDPMQKITDLQKEFYELGSLHSVVPQEDIVSSSYIIPESHE
IVDLGSMVSSTSEEKKLLDADTAYEELMKRQQMQLTPASSPTQPPIRDDVTESTMDFDRV
ADASLTSSILSGASLTDSTSSATLSIPDVKITQHFSTEEIEDEYVTDYTREIQEIIAHES
LILTYSEPSESATSVPPSDTPSLTSSVSSVCTTDSSSPITTLDSITTVYTEPADVVTKFK
DSEGISSPTYFPGSIIDYPDEISISLDRPSSIPSGLVFTHRPEPGKPPIAPXTQRFLSFP
ITTQKSTDTPPKPSALSLTSTMTLNLVTSADYKLPSPTSPLSPHSNKSSPRFSKSLMETY
VVITLPSEPGTPTDSSAGQAITSWPLGSPPKDLVSIEPVFSAPPVTAAAIPSSSEQRLYM
SGALETFSAIPVTTLSTFQPAPSSAAKFLTTEVPKVEVSAAKSTVPSIGPSSVSITIPPE
HLALDTLHLEKHQYKENGKLQPVGDIIDLRTVPKVEVKVTEKCMDLSAPMMDVKRQTTSI
DVYGRQISTVQPSIINLSAASSAASSVVTPISLVTEAVTVVTCTASASYSTGTESFMGIE
PTMTTPLQLTTSKYAEPPYRTPSGQAFPTLKEEAPINLSRSTPAQAATLAITKPVTVPPA
GITNGWTDSTTSQGISDGEAVDLSTTKSHRTVVTVDESTSSAVTKIIEDDEKPVDLTAGR
RAVCCDMVYKLPFGRSCTAQQPATTLPEDPDAVTSLSALHQSQPMPRSYFLTTGTSETDI
AVTAIDINASLQTITMETFRAETIDTVPTLTTASEVFAEVVEEESALLIVPEEDKQQQQL
DLERELLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQSMKQHLLYQQEEE
RQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEEQKIRQIYQYNYDPSGTVSPQTTTEQ
AILESQYAAPEGAQFWGTDEATTTASAVVAIEIPQSQGWYTVQSDGVTQYIAPPGILTTV
SEIPLTDVVVKDEKQPKKRSSGAKVRGQYDEIGENMGDDPRGFKKIVDSGKVLHPDMAKV
PPASPKTAKMMQRSMSDPKPLSPTADESSRASFQYTEGYTTKGSQTMTSSGTQKKVKRTL
PNPPPEETSTGTQSTFSTMGTTSRRRICRTNTMARAKILQDIDRELDLVERESAKLRKKQ
AELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRP
TRIESQHGIERPRTAPQTEFSQFIPPQTQPESQLVPPTSPYTQYQYSSPALPTQAPTPYT
QQSHFEQETLYHQQVSPYQTQPAFQTVATMSFTPQAQPTPTPQPSYQLPSQMMVIQQKPR
QTTLYLEPKITSNYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEERSSMASS
PISSISADSFYADIDHHTPRNYVLIDDIGEITKGTAALSTAFSLHEKDLSKTDRLLRTTE
TRRSQEVTDFLAPLQSSSRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGAESLDHLAG
LSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKMSKFS
PIQESRDLEPDYSSYITSSTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGSGL
GTIGSTMRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSLKRDSSSSSLRLKAQEAEAV
DVSFSHASSSGRTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPI
SADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEGKLGLKLTCYS
RNSNSFFXACLIFLLQRCILLFLVCLLHVYFDFISCEWKFCLVYRFCSMLFFISF
NT seq 7728 nt   +upstreamnt  +downstreamnt
atgagtgtggagagaagagatcaggaaatgagtgacaggagggagaagtgggaaaaggaa
gatgacaaatcagacgcctcaagctctcagcagccaaaaagcccccaaggtctgagtgac
acagggtactcttctgatggaatatcaagctcacttggtgaaattccgagtcatattcca
agcgatgaaaaggatttgctcaagggcctcaaaaaggactttttttcccaggaaagcagt
ccttccagtccctctgatttggctaagttagaaagtactgtcctatctattttggaagct
caatctagtacacttgttgatgaaaagtcagaaaagaaaacaaaaccccagggagtttct
ccagagcaacctaaagaccaacagaaaactcagactttttctgaaacgctggaaattact
gttccagaagagccacccaaggaaagtcaagaagaaaagaaagacacttttaaaaaagat
gaccaacaagggcatcccttccagaaaaggactataaagaaaagtttgagtttgttgatg
aacatagctggaagaaggcaaacttatgattcagttgaagatagcagtgaaagtgaaaac
tcacctgttccacaaagaaaacggagaactagtgttggttcctcaagcagtgatgagtat
aaacaggaagatagtcaaggatcaggtgaagaggaagacttcattcgaaagcaaatcata
gaaatgagtgctggtgaagatgcttcaggttctgaggatgatgagtttattaagaaccaa
ctcaaagagattagcagtagtatagaaagccagaagaaggaagaaacaaaaggaaaagga
aaagcaacagcagggaaacacaagcgactgacaagaaaaagtagtgcgagctttgatgac
gatgtagggagacgtcattcatggcatgatgaagatgatgagatgtatgatgacagttct
gaacttaaatacagagaaaccaaaagtcaagagagtgaagaacttgcagttgctggaggt
ggagggctacgtcgatttaaaaccattgaactcaacagcacaatcacagataagtattct
gcagagtcatcacagaaaaaaacaactttgtattttgatgaagagccagaattagaaatg
gaaagcctgacagactcaccagaagataggtcaaggggggaaggatcttctagtcttcat
gcttccagcttcactcctggtacatcccctacctcagtgtcatcacttgatgaggatagt
gacagtagcccaagtcacaaaaaaggagagagcaaacagcaacgcaaagcgcggcacaga
tcacatggccctcttctacctactatagaggattcttcagaggaagaagaattgagagag
gaagaagaattattaaaagagcaagaaaagcagcgggagttagaacagcaacaaagaaag
acttctagtaaaaaatcaaaaaaagacaaagatgaacttcgagctcagagaaggagagag
agaccaaagacaccacccagcaatctctctcccattgaagatgcttctccaacagaagaa
ttacgtcaggctgcagaaatggaggagctccaccgatcttcttgttctgaatattcgcct
agcattgaatcagacccagagggttttgaaataagcccagaaaaaataatagaagtacag
aaagtttataaattgcccacagctgtgtctttatactccccaacagatgagcaatctatt
atgcagaaagaaggtggccaaaaggcattaaaaagtgctgaggagatgtatgaagaaatg
atacataaatcccacaaatataaagcttttccagctgcaaatgaacgagatgaagtgttt
gaaaaagaacctttatatggtgggatgttaatagaagattatatttatgagtcgttagta
gaggacacatacaatggatcagtagatggcactttgctaacaagggaagacgaagaaaat
ggatttatgcagcagaaagggagagagcaaaaaataagacttccggaacagatttatgaa
gaccctatgcagaagattacagacctccagaaagagttttatgagttaggaagcttgcat
tctgttgtgcctcaagaagatattgtttcaagctcttatatcatcccagagagccatgaa
atagtagatcttggcagtatggtaagttctaccagtgaagaaaaaaaattattagatgct
gatactgcctatgaagaactcatgaagaggcaacagatgcagctaacacctgcatccagt
ccaacccagccccccatcagggacgatgtgacagagtccaccatggactttgatagggtg
gccgatgcgtctttgacatcaagcattctctcaggtgcatctcttacagattcaaccagc
agtgcgacactctctattccagatgttaaaataacccaacatttttcaacagaagaaatt
gaggatgaatatgtaactgattatacaagagaaattcaagaaataattgcccatgaatca
ctgattttgacctattctgagccctcagaaagtgctacatctgtcccaccatctgataca
ccttctcttacatcatctgtttcttcggtttgcaccacagatagctcctcacctattact
accctggatagcataaccacagtttatacagagccagcggatgtagtaactaaatttaaa
gattctgagggaatttcttcaccaacttatttcccaggcagcattattgactatccggac
gaaataagtatatcgttagataggccgtcttcaattccatctgggcttgtatttacacat
aggcctgagccaggcaaacctccaattgccccctaaacccagcggttcctcagcttccca
ataactacacaaaaatcaacagatacacctcccaagccaagtgctttatctttaacttca
actatgacactgaatttagtgacttcagcagattataaattgccttcccctacctcccca
ctttccccccactctaacaagtcttcaccaagattttccaaatccctcatggaaacctat
gtggttatcacattgccatctgaacctgggactccaacagattcttccgctggtcaagca
attaccagttggcccctaggatcaccccccaaagatctggtttccattgaaccggtgttt
tctgctcctcctgtaacagctgcagcaattccaagttcctcagagcagagactatacatg
tcaggagctttggagacattttctgctatccctgtcacaacactgtctacatttcaacca
gccccatcttcagctgcaaaatttctcacaactgaagttcccaaagttgaagtttcagca
gctaaaagtacagtccctagtattggtcccagcagtgtctctataacaattcctccagaa
catcttgctctagataccctacatttagagaagcatcagtataaggagaatggaaaattg
caacctgttggtgatatcattgatctgcgtacagtaccaaaagtagaagttaaagtaacc
gaaaaatgtatggatctttctgctcctatgatggatgtgaaaaggcagaccacatcaatt
gatgtttatgggagacaaattagcaccgtgcaaccatccattataaatcttagtgcagcc
tcatcagcagcctcatcagtagtgaccccaatatccctggtcactgaagcagtgacagtt
gtcacatgcacagctagtgcaagttacagcacaggcacagaaagctttatgggtatagaa
cctacaatgacaacaccactccagctaactacgtcaaagtatgctgagcccccatatagg
acaccaagtggtcaagcctttcctacgcttaaggaggaagcaccaataaacttatcgcga
agtactccagcacaagcagcgacactggctattacaaaacctgtcactgtacctcctgct
ggtattacaaatggatggactgatagcaccacatcccaagggatcagtgatggggaagca
gtggatctcagtaccacaaagtctcatagaactgttgtaacagtggacgaatctacttca
agtgcagtgaccaaaataatagaagatgatgaaaaacctgttgatctgactgcaggaaga
agagctgtgtgctgtgacatggtttataagttaccttttggaaggagttgcacagcacag
caacctgcaactactcttcctgaggatcccgatgcagtgacttcattatctgccctgcat
cagagccagccaatgcccagatcgtatttcctaacaacaggtacatctgaaacggacatt
gcagtaactgctattgatatcaatgccagcttgcaaaccattaccatggaaacttttaga
gctgagacaatagacactgttcccactttaaccacagcatctgaagtgtttgctgaagtg
gtggaagaagaaagtgctcttttaattgtccctgaagaagataaacaacaacagcagtta
gacttggagcgtgaactcttggaactggagaaaatcaagcagcagcgctttgctgaggaa
ttggagtgggaacgccaggaaattcaaaggttccgagaacaagaaaagatcatggttcaa
aaaaagctggaggagctgcagtcaatgaagcagcaccttctctatcagcaagaagaagag
cggcaagcccagtttatgatgaggcaggagacgctggctcagcaacagttacagcttgag
cagatccaacagctacagcaacagcttcaccaacagctagaggagcaaaagattcgccag
atctatcagtataactatgacccttctggaactgtctctccacaaaccactacagagcag
gcgattttagaaagtcagtatgccgccccagaaggtgctcagttttgggggaccgacgag
gcaaccactacagcttcagctgttgtggcaattgaaataccacaaagccaaggatggtac
acagttcagtctgatggcgttactcaatacattgccccacctggcattctgacaactgtt
tcagaaatacctctaactgatgttgttgtaaaagatgaaaaacaacccaaaaagcgaagt
tctggagctaaagtccgtggacagtatgatgaaataggagaaaatatgggagatgacccc
cgaggttttaaaaagatagtggacagtggtaaagtactgcatccggatatggctaaagtt
cccccagcaagtcctaagacagccaagatgatgcagcgttctatgtctgaccccaagcct
ctgagtcctacagcagatgagagttccagggcctcttttcagtatactgagggctacacg
acgaaaggttctcaaaccatgacatcctccggcacccagaaaaaagttaagagaacgctg
ccaaatccacctcctgaggagacttccacgggaactcagtctacgttcagcacgatggga
accacttctagaagaaggatctgcagaaccaacacaatggcacgagctaagattctccag
gacatagacagggagcttgatcttgtggagagggaatcggcaaagcttagaaagaaacaa
gcagaacttgatgaggaagaaaaagaaattgatgccaaactacggtacttggaaatgggt
attaataggaggaaagaggcattgttaaaggagagagagaagagagagcgagcctacctc
cagggcgtagctgaggatcgtgattacatgtctgacagtgaagtgagcagcaccaggcca
acccgaatagaaagtcagcatgggatagaacgacctagaactgctccccaaactgaattc
agccagtttataccaccacaaacccaacctgaatctcaactagttcctcctacaagtcct
tatacacaataccagtactcttcccctgctcttcctacccaagcaccaactccatacacc
caacagtcccactttgaacaagaaactttgtaccatcagcaagtttcaccttatcagact
cagccagcctttcaaactgtggcaacaatgtccttcacgcctcaagctcaacctacacca
accccacaaccttcttatcagttaccatcacagatgatggtgatacaacaaaagccacgg
caaaccacattatatttggagcccaaaataacttcaaactatgaggtgattcgtaaccaa
cccctgatgatagcacctgtctctactgataacacatatgctgtttcccaccttggcagt
aagtacaatagtttagacttgaggataggtttggaggaaagaagtagcatggcaagcagt
ccaatatcaagcatatctgctgattctttctatgcagatattgaccatcacaccccacga
aattatgtcctaattgatgacattggagagataaccaaaggaacagcggcgttaagcact
gcgtttagccttcatgaaaaggatctgtcaaaaacagaccgtcttctgagaaccactgag
acacgtaggtcacaagaagtgacagattttctagcacctttacagagttcctccagattg
cacagttatgtgaaagcagaggaagacccaatggaggatccttatgagttaaaacttctg
aaacatcaaattaaacaagaattccgtagaggagcagagagcttagatcaccttgctggc
ctttcccattattaccatgctgacactagctatagacactttccaaaatctgaaaaatac
agcatcagtagactcacgcttgaaaaacaagcagcaaaacaactaccagcagccatactt
tatcaaaagcagtcaaagcataagaaatcattaattgaccctaaaatgtcaaaattttca
cctattcaagaaagtagagaccttgaacctgattattcaagttatataacttctagcact
tcatctattggtggcatttcttccagggcaaggcttcttcaagatgacatcacttttggc
ctcagaaaaaatattacagaccaacaaaaatttatgggatcatcccttggttcaggactg
ggcacaataggaagtaccatgcggtcagctctgcaggatgaagcagataagccatacagt
agtggcagtaggtccagaccttcctccagaccttcctctgtctatgggcttgatttatca
cttaaaagagattcttccagctcttccctaagactaaaagctcaagaggctgaagctgta
gatgtttcctttagtcatgcatcatcctctggaagaactaaacctaccagtttgccaatt
agccagagtagaggaagaataccaattgtggcccagaactctgaagaagaaagtccattg
agtcctgttggccaaccaatgggaatggccagggctgcagctggacctctaccaccaata
tctgcagacaccagggatcagtttggatcaagtcactcattgcctgaagttcagcaacat
atgagagaagaatcacggactcgaggctatgaccgtgacatagcattcatcatggatgac
ttccaacatgccatgtcagatagtgaaggtaaattgggcctcaaattaacttgttattct
cgaaactcaaactcattttttnntgcatgtttgattttccttctccaaagatgtattcta
cttttcttggtgtgtcttttgcatgtttacttcgattttatttcttgtgaatggaaattt
tgtcttgtatatagattttgtagcatgcttttctttatttctttttag

DBGET integrated database retrieval system