KEGG   Loxodonta africana (African savanna elephant): 111750521
Entry
111750521         CDS       T04351                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04630  JAK-STAT signaling pathway
lav04640  Hematopoietic cell lineage
lav04664  Fc epsilon RI signaling pathway
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05221  Acute myeloid leukemia
lav05310  Asthma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111750521
   04151 PI3K-Akt signaling pathway
    111750521
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111750521
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111750521
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111750521
   04664 Fc epsilon RI signaling pathway
    111750521
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111750521
   05202 Transcriptional misregulation in cancer
    111750521
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    111750521
  09163 Immune disease
   05310 Asthma
    111750521
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    111750521
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    111750521
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interleukins
   111750521
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Haparin
  Cytokines
   111750521
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 111750521
NCBI-ProteinID: XP_023403303
LinkDB
Position
Unknown
AA seq 142 aa
MSSLPILHLLLLLLSLELQAPKAQGMPVTAPQHYSVMINEIKEILQKSPPLNSATPSDTE
KTILRDRASLKPNLDAFLKATENFKEKGGSSISKNLRKFHPCLPKAKPQTASVVIQNDWE
DFRGKLYPYLETLKAFLMGRLT
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagcagcctccccatcctacaccttctcctgctcctgctcagccttgaacttcaagcc
cccaaggcccaggggatgcctgtgacagcaccccagcattacagtgtgatgatcaatgaa
atcaaggagatcttacagaagtctccacctttgaattcagcaacccccagcgacacagaa
aagaccatcctgagggaccgcgcctcgctgaagccaaacctagatgcgttcctgaaagct
accgagaatttcaaggagaaaggaggatcctcaattagtaaaaatcttaggaaattccac
ccatgcctgcccaaggccaagccccagacagcctcagtcgtcatccagaatgactgggaa
gacttccgggggaagttatatccatatctggaaaccctaaaagcttttctaatgggcaga
ctgacatag

DBGET integrated database retrieval system