KEGG   Loxodonta africana (African savanna elephant): 111750616Help
Entry
111750616         CDS       T04351                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
lav  Loxodonta africana (African savanna elephant)
SSDB OrthologParalogGFIT
Motif
Pfam: IQ Peptidase_S64
Motif
Other DBs
NCBI-GeneID: 111750616
NCBI-ProteinID: XP_023403846
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MSEGAYQRLWESSHVTLQELLDKEQPLLDPVPDRERQSFQHRLSLLYLSYLGLLRRLDTI
YDQMVQPQKRRLLRRLLDGVAGRVLELQEDLVCAELSECCCLDHVLQGLKLTPAELEVPI
PKYFLLEQANILKDRGLMLAEILSKMEPVSSEESFPGMHRAEAIIVLQRAERARQGRLRA
KFMQEIRKEEERDRKSREDGRRKFTQDQASVIIQKVWKGYLQRKRTEQDRQVEMEFIGML
PSPNETEHLGILSQACLREDVRRLRQMEKEEEFQLAMTQTHDSLMEIEGPDMKEKMKEQI
RQWFIECHALTGRFPDYPDESAGGSYLIFADKTPEQVRMELELQVQENKKKEQEKNKNKD
EEKKEKKKGKEEKAKKGEVDDMLKVLPSKFIPVINAGHEEYMKLWKNRYESIHPNQSFDP
ETLREEKRKEVEVEIRMQVDELMRQELKNLRLAVDREEGRPLKAPKKKPGKKAGKKKKEK
DLTLNRSLESLFEELVIHGLLKKSETVALKDYVGDCLHLGSTLNVANKLPMPSLFDIRQN
MALYGVLRLGEKPLGMDPKRIKKDLTKALRLLNPGDRVMLIGTTAQPQLAEMKGLCRTYE
RILLVPRPDYASRYVLWKHMIETQGVQVTQSLDISALAKVSDGYTPGHILQATQSVLTER
RLLQLSKRPLVASEFLGHLAKLEPVYKEEEESLKDWYFKTPLGKKRMKLNKEQMEAEEAR
MTKERKKKK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggagcctaccagcgcctctgggagtcctcccacgtgacactgcaggagctg
ctggacaaggagcagcccctgctcgaccccgtgcccgaccgggagcgccagtccttccag
caccggctctcattactctacctgtcctacctggggctgctacgccgcctggacaccatc
tacgaccagatggtgcagccgcagaagcggcggctgctgcggcgcctgctggacggggtg
gcgggccgcgtgctggagctgcaggaggacctggtgtgcgctgaactcagcgagtgctgc
tgcctggaccacgtgctgcaggggctcaagctcacaccggcagaactggaggttccaatt
cccaaatacttcctgttggagcaggccaacattctgaaagaccgggggttgatgttggca
gagattctgtccaaaatggagccagtgtcctctgaggagagttttccaggaatgcaccgg
gctgaggccataatcgtgctgcaaagagctgagagggctcggcaaggccggctccgtgca
aagtttatgcaggaaattcggaaagaggaagagcgggatcggaagagccgggaggatggg
aggcgcaagttcactcaggaccaggcatctgtcatcatacagaaggtgtggaaaggctac
ttgcagaggaaacgcacagagcaggaccggcaagtagagatggagtttatcggcatgctg
ccctcacccaacgagacggagcacttgggcatcctgtcccaggcctgcctcagggaggat
gtccggaggctccgccagatggagaaggaggaggagttccagctggccatgacgcaaacc
catgattctctcatggagatcgaggggcccgacatgaaggagaagatgaaggagcaaatt
cgacagtggtttattgagtgccatgcccttactggccggtttcctgactatccagatgaa
tctgcaggtggatcctacttgatctttgcagacaagactccagaacaggtgagaatggag
ctggagctgcaggtccaggagaacaaaaagaaggagcaagagaaaaataagaacaaggat
gaggagaaaaaagagaagaagaaggggaaggaagaaaaggccaagaagggggaagtggat
gatatgctgaaagtgttgccatccaaatttatacctgtgatcaatgctgggcatgaggag
tacatgaagctatggaagaaccgctatgagagcatacaccccaatcagagttttgaccct
gagaccctccgggaggaaaagaggaaagaagtggaagtggagatccgcatgcaggtagat
gagctgatgcggcaagagctgaagaacctgcgcctggccgtggacagggaggaggggaga
cccttgaaggctccaaagaagaagcctgggaagaaagctggaaagaagaagaaggaaaaa
gatctgaccctaaacaggtccctggagtcgctgttcgaagagcttgtcatccatggcctt
ctgaagaagagtgagacagtggcactgaaggattacgttggtgactgcctccatcttgga
tccactctgaatgtggccaacaagttgcccatgccctccctgtttgacattcgtcagaac
atggccttgtacggggtcctccggctcggtgagaagcccctggggatggatccaaagcga
ataaagaaggacctcaccaaggccctgcgcctgctgaaccctggagaccgcgtgatgttg
attggaacaacagcccagccacagctggccgagatgaaggggctgtgccggacctatgag
cgcatcctccttgtgccccggcccgactacgcctcccgctatgtgctctggaagcatatg
atagagacccagggagtccaggtgacccagagcctggacatcagtgccctggccaaggtg
tcagatggttacacacctggccacatcctccaagccacccaatcagtgctgaccgagcgg
cggctcctgcaactgtccaagcggcccctagtggcctctgagttcctggggcacctggcc
aagctggagccggtgtacaaagaggaggaggaatccctgaaggactggtacttcaagact
ccactgggcaaaaagagaatgaagcttaacaaggagcagatggaggccgaggaggccagg
atgacaaaggagagaaagaaaaagaagtga

DBGET integrated database retrieval system