KEGG   Loxodonta africana (African savanna elephant): 111753233
Entry
111753233         CDS       T04351                                 

Gene name
BIK
Definition
(RefSeq) bcl-2-interacting killer isoform X1
  KO
K18452  Bcl-2-interacting killer
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111753233 (BIK)
SSDB
Motif
Pfam: bcl-2I13
Other DBs
NCBI-GeneID: 111753233
NCBI-ProteinID: XP_023415633
LinkDB
Position
Unknown
AA seq 221 aa
MASAESGVRWPHHFRVSVRLSVFFPREEMSQGGSVSRNLLLATYVYGQVPGHLPNEEVSG
MTDPMVYFESADLSAPPISDSARVGLRLALIGDEMDLWLRTPRLVQLAGLALTTVHSLVF
NHIQTGVRSVFRSFNSCLTNLRESMWARRLLARRNWVRASHEADVTALTCIPISCTCDHL
ELELGGSWIAAVLTTPYCLTCFTHLTLPAWSQRSLGLRLLV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcctcagcagagtcaggggtcaggtggccacatcattttagggtttcagtcaggctc
tctgttttctttcccagagaagaaatgtcacaaggtggatctgtctccaggaacctcctg
cttgccacctacgtatatgggcaggtccctggacacctgccgaatgaggaggtttccggc
atgaccgaccccatggtgtacttcgaatccgcagacctgtcagcccctcccatcagcgac
tctgcccgggtgggcctgcggctggccctcattggggacgagatggacctgtggctcagg
accccccgcctcgtccagctggccgggctggccctcaccactgtgcacagcttggttttc
aaccacatccagacaggcgtgaggagtgtttttagaagttttaacagttgtctcaccaac
ctcagggagagcatgtgggcccggagactcctggcccgcaggaactgggtaagagcttct
catgaagccgatgtcacggctctgacttgtatccccatatcctgcacttgtgaccatctg
gagctggagctgggtggcagctggattgccgcagtcctcaccactccctattgtcttacc
tgcttcacccacttaacactacctgcctggtcccaaaggtctttgggtttgagactcctg
gtttag

DBGET integrated database retrieval system